delta 2 Catenin Antibody (6E11)

Images

 
Western Blot: delta 2 Catenin Antibody (6E11) [H00001501-M01] - CTNND2 monoclonal antibody (M01), clone 6E11. Analysis of CTNND2 expression in K-562.
Western Blot: delta 2 Catenin Antibody (6E11) [H00001501-M01] - CTNND2 monoclonal antibody (M01), clone 6E11 Analysis of CTNND2 expression in PC-12.
Western Blot: delta 2 Catenin Antibody (6E11) [H00001501-M01] - CTNND2 monoclonal antibody (M01), clone 6E11. Analysis of CTNND2 expression in Raw 264.7.
ELISA: delta 2 Catenin Antibody (6E11) [H00001501-M01] - delta 2 Catenin Antibody (6E11) [H00001501-M01] - Detection limit for recombinant GST tagged CTNND2 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
6E11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

delta 2 Catenin Antibody (6E11) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
CTNND2 (NP_001323, 1081 a.a. ~ 1190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLYRNSYGAPAEDIKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLG
Specificity
CTNND2 - catenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CTNND2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publications using H00001501-M01.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for delta 2 Catenin Antibody (6E11)

  • catenin (cadherin-associated protein), delta 2 (neural plakophilin-relatedarm-repeat protein)
  • catenin delta-2
  • Delta-catenin
  • GT24T-cell delta-catenin
  • Neural plakophilin-related ARM-repeat protein
  • Neurojungin
  • NPRAPneurojungin

Background

Armadillo-like proteins are characterized by a series of armadillo repeats, first defined in the Drosophila 'armadillo' gene product, that are typically 42 to 45 amino acids long. These proteins can be divided into subfamilies based on the number of repeats, their overall sequence similarity, and the dispersion of the repeats throughout their sequences. Members of the p120(ctn)/plakophilin subfamily of Armadillo-like proteins, including CTNND1 (MIM 601045), CTNND2, PKP1 (MIM 601975), PKP2 (MIM 602861), PKP4 (MIM 604276), and ARVCF (MIM 602269), have 10 armadillo repeats each (Bonne et al., 1998 [PubMed 9721216]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for delta 2 Catenin Antibody (H00001501-M01)(3)

Reviews for delta 2 Catenin Antibody (H00001501-M01) (0)

There are no reviews for delta 2 Catenin Antibody (H00001501-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for delta 2 Catenin Antibody (H00001501-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional delta 2 Catenin Products

Research Areas for delta 2 Catenin Antibody (H00001501-M01)

Find related products by research area.

Blogs on delta 2 Catenin

There are no specific blogs for delta 2 Catenin, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our delta 2 Catenin Antibody (6E11) and receive a gift card or discount.

Bioinformatics

Gene Symbol CTNND2
Entrez
OMIM
Uniprot