We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human DEGS1 GST (N-Term) Protein

Images

 
Recombinant Human DEGS1 Protein [H00008560-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human DEGS1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-323 of Human DEGS1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
DEGS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
64.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DEGS1 GST (N-Term) Protein

  • Cell migration-inducing gene 15 protein
  • Degenerative spermatocyte homolog 1
  • degenerative spermatocyte homolog 1, lipid desaturase (Drosophila)
  • degenerative spermatocyte homolog, lipid desaturase (Drosophila)
  • DEGS
  • DEGS1
  • DES1
  • Des-1
  • DES1degenerative spermatocyte homolog, lipid desaturase
  • EC 1.14
  • EC 1.14.19.17
  • EC 5.2.1.-
  • FADS7
  • membrane fatty acid (lipid) desaturase
  • Membrane lipid desaturase
  • MGC5079
  • MIG15
  • migration-inducing gene 15 protein
  • MLDdihydroceramide desaturase
  • Retinol isomerase
  • sphingolipid delta 4 desaturase
  • sphingolipid delta(4)-desaturase DES1

Background

This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. Two splice variants have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00154
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NB600-717
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, RIA, RI, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP3-04784
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-46476
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, KO, WB
H00000439-M03
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
MAB1266
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
NBP1-60109
Species: Hu
Applications: B/N, Flow, WB
AF1638
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP3-48017
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP1-82648
Species: Hu
Applications: ICC/IF,  IHC-P, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP1-86687
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-47801
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-45519
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-46376
Species: Hu
Applications: IHC,  IHC-P, WB
H00008560-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for DEGS1 Recombinant Protein (H00008560-P01) (0)

There are no publications for DEGS1 Recombinant Protein (H00008560-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DEGS1 Recombinant Protein (H00008560-P01) (0)

There are no reviews for DEGS1 Recombinant Protein (H00008560-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DEGS1 Recombinant Protein (H00008560-P01). (Showing 1 - 2 of 2 FAQ).

  1. We would like to remove the GST fusion from the DEGS1 recombinant purified protein (H00008560-P01). Can you tell us how to do this (protease digest site) and reference any relevant products we can purchase to remove it?
    • The recombinant protein you are referring to is an Abnova product, a company based in Taiwan. Please see our GST tag removal protocol. They were unable to pinpoint a specific method for GST tag removal being more advantagous to another so I would invite you to visit our website via the link I provided you exploring that option.
  2. I'm currently using your recombinant degs1 (H00008560-P01) in an enzyme assay, and I need to get the GST tag alone to confirm its activity as a negative control. Since you have 29 GST tags available, I'm not sure which you used for this protein. Can you tell me which one to purchase for a proper control? Also, would it be possible to purchase the vector with this degs1-gst fusion construct?
    • We distribute H00008560-P01 for Abnova, a company based in Taiwan. Are you looking for an antibody for a GST tag or a recombinant GST tag protein? Abnova considers the protein sequence of their GST tag to be proprietary, and will not release this information, but they do have an antibody specific for their GST tag, MAB0042-M01. Unfortunately, Abnova does not sell the vectors for any of their proteins.

Additional DEGS1 Products

Research Areas for DEGS1 Recombinant Protein (H00008560-P01)

Find related products by research area.

Blogs on DEGS1

There are no specific blogs for DEGS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DEGS1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DEGS1