Recombinant Human DEGS1 GST (N-Term) Protein Summary
| Description |
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-323 of Human DEGS1 Source: Wheat Germ (in vitro) Amino Acid Sequence: MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE |
Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
DEGS1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Theoretical MW |
64.3 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human DEGS1 GST (N-Term) Protein
Background
This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. Two splice variants have been identified. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, KO, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
Species: Hu
Applications: B/N, Flow, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB, ELISA, MA, AP
Publications for DEGS1 Recombinant Protein (H00008560-P01) (0)
There are no publications for DEGS1 Recombinant Protein (H00008560-P01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DEGS1 Recombinant Protein (H00008560-P01) (0)
There are no reviews for DEGS1 Recombinant Protein (H00008560-P01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DEGS1 Recombinant Protein (H00008560-P01). (Showing 1 - 2 of 2 FAQ).
-
We would like to remove the GST fusion from the DEGS1 recombinant purified protein (H00008560-P01). Can you tell us how to do this (protease digest site) and reference any relevant products we can purchase to remove it?
- The recombinant protein you are referring to is an Abnova product, a company based in Taiwan. Please see our GST tag removal protocol. They were unable to pinpoint a specific method for GST tag removal being more advantagous to another so I would invite you to visit our website via the link I provided you exploring that option.
-
I'm currently using your recombinant degs1 (H00008560-P01) in an enzyme assay, and I need to get the GST tag alone to confirm its activity as a negative control. Since you have 29 GST tags available, I'm not sure which you used for this protein. Can you tell me which one to purchase for a proper control? Also, would it be possible to purchase the vector with this degs1-gst fusion construct?
- We distribute H00008560-P01 for Abnova, a company based in Taiwan. Are you looking for an antibody for a GST tag or a recombinant GST tag protein? Abnova considers the protein sequence of their GST tag to be proprietary, and will not release this information, but they do have an antibody specific for their GST tag, MAB0042-M01. Unfortunately, Abnova does not sell the vectors for any of their proteins.
Additional DEGS1 Products
Research Areas for DEGS1 Recombinant Protein (H00008560-P01)
Find related products by research area.
|
Blogs on DEGS1