DEFB104A Antibody

Images

 
Immunohistochemistry: DEFB104A Antibody [NBP2-59792] - Immunohistochemical staining of human epididymis shows extracellular positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DEFB104A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acid sequence: EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DEFB104A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DEFB104A Recombinant Protein Antigen (NBP2-59792PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for DEFB104A Antibody

  • DEFB104B
  • DEFB-4
  • defensin, beta 104A
  • defensin, beta 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2758
Species: Hu
Applications: IHC, WB
NB200-117
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-34906
Species: Hu
Applications: BA, Func, PAGE
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
AF8198
Species: Hu
Applications: ELISA, IHC
NBP1-76864
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
AF2200
Species: Hu
Applications: IP, WB
H00001668-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
DY421
Species: Mu
Applications: ELISA
201-LB/CF
Species: Hu
Applications: BA
NB100-56563
Species: Hu, Mu, Rt
Applications: DB, Flow-CS, Flow-IC, Flow, IHC, IHC-P, WB

Publications for DEFB104A Antibody (NBP2-59792) (0)

There are no publications for DEFB104A Antibody (NBP2-59792).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DEFB104A Antibody (NBP2-59792) (0)

There are no reviews for DEFB104A Antibody (NBP2-59792). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DEFB104A Antibody (NBP2-59792) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DEFB104A Products

Bioinformatics Tool for DEFB104A Antibody (NBP2-59792)

Discover related pathways, diseases and genes to DEFB104A Antibody (NBP2-59792). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DEFB104A

There are no specific blogs for DEFB104A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DEFB104A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DEFB104A