DEDD2 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human DEDD2. Peptide sequence: PQQQSEPARPSSEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQ The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DEDD2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for DEDD2 Antibody - BSA Free
Background
Apoptosis and inflammation are important cellular processes that are highly regulated through specific protein-protein interactions (PPI). Proteins involved in these signaling cascades often carry PPI domains belonging to the death-domain superfamily (reviewed in Kohl A and MG Grutter, 2004). These PPI domains include the death effector domain (DED), the death domain (DD), the caspase activation and recruitment domain (CARD) and the pyrin domain (PYD). PPI domains are structurally related and comprised of a six alpha helical structure; within proteins PPI domains can be found in isolation or in combination with other domains. DEDD2/Flame-3 (DED containing DNA binding2) belongs to a family of single DED-containing proteins that is targeted to the nucleus (reviewed in Barnhart et al, 2003; Slvibst ry sl, 2003). Several DED-containing proteins are involved in the regulation of apoptosis through their interactions with DED-containing caspases. It is thought that DEDD2 and its closely related homologue DEDD may mediate cell death by binding to the DED-containing caspases -8 and -10, and targeting them to the nucleus following death receptor induced apoptosis. However, the function of DEDD2 and DEDD remain to be fully elucidated, and they may also have roles in cellular processes other than apoptosis. This antibody recognizes DEDD2/Flame-3; human DED2/Flame-3 is a 326 amino acid protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: WB
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP (-), WB
Species: Hu, Mu
Applications: IHC, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: WB
Publications for DEDD2 Antibody (NBP2-88800) (0)
There are no publications for DEDD2 Antibody (NBP2-88800).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DEDD2 Antibody (NBP2-88800) (0)
There are no reviews for DEDD2 Antibody (NBP2-88800).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DEDD2 Antibody (NBP2-88800) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DEDD2 Products
Research Areas for DEDD2 Antibody (NBP2-88800)
Find related products by research area.
|
Blogs on DEDD2