DECR2 Antibody (4A7) - Azide and BSA Free

Western Blot: DECR2 Antibody (4A7) [H00026063-M03] - Analysis of DECR2 expression in Jurkat (Cat # L017V1).

Immunocytochemistry/Immunofluorescence: DECR2 Antibody (4A7) [H00026063-M03] - Analysis of monoclonal antibody to DECR2 on HeLa cell. Antibody concentration 10 ug/ml

Sandwich ELISA: DECR2 Antibody (4A7) [H00026063-M03] - Detection limit for recombinant GST tagged DECR2 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 4A7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DECR2 Antibody (4A7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse DECR2 Antibody (4A7) - Azide and BSA Free (H00026063-M03) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: DECR2 (AAH10740.1, 49 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDI
• Specificity: DECR2 - 2,4-dienoyl CoA reductase 2, peroxisomal (4A7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DECR2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DECR2 Antibody (4A7) - Azide and BSA Free

• 2,4-dienoyl CoA reductase 2, peroxisomal
• EC 1.3.1
• EC 1.3.1.34
• pDCR2,4-dienoyl-CoA reductase 2
• PDCRshort chain dehydrogenase/reductase family 17C, member 1
• peroxisomal 2,4-dienoyl-CoA reductase
• SDR17C1

Background

Auxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA. Has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19-docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DECR2
• Entrez:
  • 26063(Human)
• Uniprot:
  • AAH10740(Human)