DECR1 Antibody


Western Blot: DECR1 Antibody [NBP1-85263] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane more
Immunocytochemistry/ Immunofluorescence: DECR1 Antibody [NBP1-85263] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85263] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

DECR1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:TFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKT
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DECR1 Protein (NBP1-85263PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DECR1 Antibody

  • 2,4-dienoyl CoA reductase 1, mitochondrial
  • 4-enoyl-CoA reductase [NADPH]
  • 4-enoyl-CoA reductase
  • DECR
  • DECR1
  • DECR2,4-dienoyl-CoA reductase [NADPH]2,4-dienoyl-CoA reductase, mitochondrial
  • EC
  • SDR18C1
  • short chain dehydrogenase/reductase family 18C, member 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, Flow, IHC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P, Flow-IC
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Ca
Applications: WB, IHC, IF
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
Species: Mu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB

Publications for DECR1 Antibody (NBP1-85263) (0)

There are no publications for DECR1 Antibody (NBP1-85263).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DECR1 Antibody (NBP1-85263) (0)

There are no reviews for DECR1 Antibody (NBP1-85263). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DECR1 Antibody (NBP1-85263) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DECR1 Products

Bioinformatics Tool for DECR1 Antibody (NBP1-85263)

Discover related pathways, diseases and genes to DECR1 Antibody (NBP1-85263). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DECR1 Antibody (NBP1-85263)

Discover more about diseases related to DECR1 Antibody (NBP1-85263).

Pathways for DECR1 Antibody (NBP1-85263)

View related products by pathway.

PTMs for DECR1 Antibody (NBP1-85263)

Learn more about PTMs related to DECR1 Antibody (NBP1-85263).

Blogs on DECR1

There are no specific blogs for DECR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DECR1 Antibody and receive a gift card or discount.


Gene Symbol DECR1