DECR1 Antibody - BSA Free

Western Blot: DECR1 Antibody [NBP1-85263] - Analysis using Anti-DECR1 antibody NBP1-85263 (A) shows similar pattern to independent antibody NBP1-85264 (B).

Immunocytochemistry/Immunofluorescence: DECR1 Antibody [NBP1-85263] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria.

Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85263] - Staining of human lymph node.

Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85263] - Staining of human liver shows high expression.

Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85263] - Staining of human placenta shows low expression as expected.

Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85263] - Staining in human liver and placenta tissues using anti-DECR1 antibody. Corresponding DECR1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85263] - Staining of human cerebral cortex, liver, lymph node and placenta using Anti-DECR1 antibody NBP1-85263 (A) shows similar protein distribution across tissues to independent antibody NBP1-85265 (B).

Immunohistochemistry-Paraffin: DECR1 Antibody [NBP1-85263] - Staining of human cerebral cortex.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DECR1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DECR1 Antibody - BSA Free (NBP1-85263) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DECR1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DECR1 Protein (NBP1-85263PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DECR1 Antibody - BSA Free

• 2,4-dienoyl CoA reductase 1, mitochondrial
• 4-enoyl-CoA reductase [NADPH]
• 4-enoyl-CoA reductase
• DECR
• DECR1
• DECR2,4-dienoyl-CoA reductase [NADPH]2,4-dienoyl-CoA reductase, mitochondrial
• EC 1.3.1.34
• NADPH
• SDR18C1
• short chain dehydrogenase/reductase family 18C, member 1

Background

DECR1, also known as 2, 4-dienoyl-CoA reductase, mitochondrial, is a 36 kDa, 335 amino acid protein that catalyzes beta-oxidation in metabolism of unsaturated fatty enoyl-CoA esters with uneven double bonds. Current research is studying the involvement of the protein on diseases and disorders such as arthritis, malaria, dementia, nephropathy, brain disease, tuberculosis, anemia, and cancer. The protein interacts in metabolism, fatty acid biosynthesis, and beta oxidation pathways with other proteins such as HGS, PRKCE, ESR1, PTTG1, and SLC2A4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DECR1