Recombinant Human DEC1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DEC1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 130-229 of Human BHLHB2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
BHLHE40
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DEC1 Protein

  • basic helix-loop-helix domain containing, class B, 2
  • basic helix-loop-helix family, member e40
  • bHLHb2
  • bHLHe40
  • Class B basic helix-loop-helix protein 2
  • class E basic helix-loop-helix protein 40
  • DEC1HLHB2
  • differentially expressed in chondrocytes 1
  • Differentially expressed in chondrocytes protein 1
  • differentiated embryo chondrocyte expressed gene 1
  • Enhancer-of-split and hairy-related protein 2
  • SHARP2
  • SHARP-2
  • Stimulated by retinoic acid gene 13 protein
  • STRA13FLJ99214
  • Stra14

Background

BHLHB2 - basic helix-loop-helix domain containing, class B, 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19613
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-125
Species: Hu
Applications: WB, ICC/IF
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-485
Species: Hu
Applications: WB, IP
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P

Publications for DEC1 Partial Recombinant Protein (H00008553-Q01) (0)

There are no publications for DEC1 Partial Recombinant Protein (H00008553-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DEC1 Partial Recombinant Protein (H00008553-Q01) (0)

There are no reviews for DEC1 Partial Recombinant Protein (H00008553-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DEC1 Partial Recombinant Protein (H00008553-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DEC1 Products

Bioinformatics Tool for DEC1 Partial Recombinant Protein (H00008553-Q01)

Discover related pathways, diseases and genes to DEC1 Partial Recombinant Protein (H00008553-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DEC1 Partial Recombinant Protein (H00008553-Q01)

Discover more about diseases related to DEC1 Partial Recombinant Protein (H00008553-Q01).
 

Pathways for DEC1 Partial Recombinant Protein (H00008553-Q01)

View related products by pathway.

PTMs for DEC1 Partial Recombinant Protein (H00008553-Q01)

Learn more about PTMs related to DEC1 Partial Recombinant Protein (H00008553-Q01).
 

Research Areas for DEC1 Partial Recombinant Protein (H00008553-Q01)

Find related products by research area.

Blogs on DEC1

There are no specific blogs for DEC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DEC1 Antibody
NB100-1800
BMAL1 Antibody
NB100-2288

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DEC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BHLHE40