Recombinant Human DDX60 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DDX60 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-183 of Human FLJ20035 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKIMEDFTTFLRIVSKLADMNQEYQLPLSKIKFTGKECEDSQLVSHLMSCKEGRVAISPFVCLSGNFDDDLLRLETPNHVTLGTIGVNRSQAPVLLSQKFDNRGRKMSLNAYALDFYKHGSLIGLVQDNRMNEGDAYYLLKDFALTIKSISVSLRELCENEDDNVVLAFEQLSTTFWEKLNKV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
DDX60
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DDX60 Protein

  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 60
  • DEAD box protein 60

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-594
Species: Hu, Mu, Ca
Applications: WB, IHC-P
NBP2-59942
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-85348
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
NBP2-30564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24626
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB
NBP1-82614
Species: Hu
Applications: IHC, IHC-P
NBP1-80653
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-58102
Species: Hu
Applications: WB, ICC/IF, IHC
AF6108
Species: Hu
Applications: IHC
H00010581-B01P
Species: Hu
Applications: WB, ELISA
NBP2-03971
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, ChHa, Eq, Pm, Rb
Applications: WB, IHC, IHC-P
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00055601-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for DDX60 Recombinant Protein (H00055601-P01) (0)

There are no publications for DDX60 Recombinant Protein (H00055601-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX60 Recombinant Protein (H00055601-P01) (0)

There are no reviews for DDX60 Recombinant Protein (H00055601-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DDX60 Recombinant Protein (H00055601-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DDX60 Products

Bioinformatics Tool for DDX60 Recombinant Protein (H00055601-P01)

Discover related pathways, diseases and genes to DDX60 Recombinant Protein (H00055601-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX60 Recombinant Protein (H00055601-P01)

Discover more about diseases related to DDX60 Recombinant Protein (H00055601-P01).
 

Pathways for DDX60 Recombinant Protein (H00055601-P01)

View related products by pathway.

PTMs for DDX60 Recombinant Protein (H00055601-P01)

Learn more about PTMs related to DDX60 Recombinant Protein (H00055601-P01).

Blogs on DDX60

There are no specific blogs for DDX60, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DDX60 Antibody
NBP1-91826
GAP-43 Antibody
NB300-143

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DDX60 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX60