DDX42 Antibody


Western Blot: DDX42 Antibody [NBP1-57335] - Human Thymus lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

DDX42 Antibody Summary

Synthetic peptides corresponding to DDX42 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 42) The peptide sequence was selected from the N terminal of DDX42 (NP_031398). Peptide sequence PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DDX42 Antibody

  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 42
  • DEAD box protein 42
  • EC 3.6.1
  • EC
  • RHELPSF3b DEAD box protein
  • RNA helicase-like protein
  • RNA helicase-related protein
  • RNAHPFLJ43179
  • SF3b125 DEAD-box protein
  • SF3b125ATP-dependent RNA helicase DDX42
  • Splicing factor 3B-associated 125 kDa protein


DDX42 is a member of the Asp-Glu-Ala-Asp (DEAD) box protein family. Members of this protein family are putative RNA helicases, and are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX42 is a ATP-dependent RNA helicase. DDX42 binds to partially double-stranded RNAs (dsRNAs) in order to unwind RNA secondary structures. It also mediates RNA duplex formation thereby displacing the single-strand RNA binding protein.This gene encodes a member of the Asp-Glu-Ala-Asp (DEAD) box protein family. Members of this protein family are putative RNA helicases, and are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Two transcript variants encoding the same protein have been identified for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Po, Bv, Ca, Pm
Applications: WB, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, PLA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB

Publications for DDX42 Antibody (NBP1-57335) (0)

There are no publications for DDX42 Antibody (NBP1-57335).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX42 Antibody (NBP1-57335) (0)

There are no reviews for DDX42 Antibody (NBP1-57335). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DDX42 Antibody (NBP1-57335) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for DDX42 Antibody (NBP1-57335)

Discover related pathways, diseases and genes to DDX42 Antibody (NBP1-57335). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX42 Antibody (NBP1-57335)

Discover more about diseases related to DDX42 Antibody (NBP1-57335).

Pathways for DDX42 Antibody (NBP1-57335)

View related products by pathway.

PTMs for DDX42 Antibody (NBP1-57335)

Learn more about PTMs related to DDX42 Antibody (NBP1-57335).

Blogs on DDX42

There are no specific blogs for DDX42, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DDX42 Antibody and receive a gift card or discount.


Gene Symbol DDX42