DDX25 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:KQVTIVVNFDLPVKQGEEPDYETYLHRIGRTGRFGKKGLAFNMIEVDELPSLMKIQDHFNSSIKQLNAEDMDEIE |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DDX25 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for DDX25 Antibody
Background
DDX25, also known as ATP-dependent RNA helicase DDX25, consists of a 54.7 kDa and a 42 kDa isoform and is involved in regulation of translation and export of mRNA during development of spermatid. The protein has been utilized in current research of diseases and disorders such as pneumonia, malaria, male infertility, and azoospermia. The protein is found in RNA binding pathways in the testis, pituitary, and hypothalamus.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ec
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, IHC
Publications for DDX25 Antibody (NBP1-83329) (0)
There are no publications for DDX25 Antibody (NBP1-83329).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DDX25 Antibody (NBP1-83329) (0)
There are no reviews for DDX25 Antibody (NBP1-83329).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DDX25 Antibody (NBP1-83329) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DDX25 Products
Research Areas for DDX25 Antibody (NBP1-83329)
Find related products by research area.
|
Blogs on DDX25