DDX25 Antibody

Product Discontinued

DDX25 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KQVTIVVNFDLPVKQGEEPDYETYLHRIGRTGRFGKKGLAFNMIEVDELPSLMKIQDHFNSSIKQLNAEDMDEIE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX25
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DDX25 Antibody

• DEAD (Asp-Glu-Ala-Asp) box polypeptide 25
• DEAD box protein 25
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 25
• EC 3.6.1
• EC 3.6.4.13
• Gonadotropin-regulated testicular RNA helicase
• GRTHATP-dependent RNA helicase DDX25

Background

DDX25, also known as ATP-dependent RNA helicase DDX25, consists of a 54.7 kDa and a 42 kDa isoform and is involved in regulation of translation and export of mRNA during development of spermatid. The protein has been utilized in current research of diseases and disorders such as pneumonia, malaria, male infertility, and azoospermia. The protein is found in RNA binding pathways in the testis, pituitary, and hypothalamus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX25