![Immunohistochemistry-Paraffin: DDHD1 Antibody [NBP2-13903] - Analysis in human testis and skeletal muscle tissues using NBP2-13903 antibody. Corresponding DDHD1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/DDHD1-Antibody-Immunohistochemistry-Paraffin-NBP2-13903-img0013.jpg "Immunohistochemistry-Paraffin: DDHD1 Antibody [NBP2-13903] - Analysis in human testis and skeletal muscle tissues using NBP2-13903 antibody. Corresponding DDHD1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit DDHD1 Antibody - BSA Free (NBP2-13903) is a polyclonal antibody validated for use in IHC and WB. Anti-DDHD1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: NTAMMREAARKIEERHFSNHATHVEFLPVEWRSKLTLDGDTVDSITPDKVRGLRDMLNSSAMDIMYYTSPLYRDELVKGLQQELNRLYSLFCSRNPD |
| Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DDHD1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for DDHD1 Antibody (NBP2-13903)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DDHD1 |
![Immunohistochemistry-Paraffin: DDHD1 Antibody [NBP2-13903] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/DDHD1-Antibody-Immunohistochemistry-Paraffin-NBP2-13903-img0009.jpg "Immunohistochemistry-Paraffin: DDHD1 Antibody [NBP2-13903] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: DDHD1 Antibody [NBP2-13903] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/DDHD1-Antibody-Immunohistochemistry-Paraffin-NBP2-13903-img0010.jpg "Immunohistochemistry-Paraffin: DDHD1 Antibody [NBP2-13903] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: DDHD1 Antibody [NBP2-13903] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/DDHD1-Antibody-Immunohistochemistry-Paraffin-NBP2-13903-img0011.jpg "Immunohistochemistry-Paraffin: DDHD1 Antibody [NBP2-13903] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: DDHD1 Antibody [NBP2-13903] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/DDHD1-Antibody-Immunohistochemistry-Paraffin-NBP2-13903-img0012.jpg "Immunohistochemistry-Paraffin: DDHD1 Antibody [NBP2-13903] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot: DDHD1 Antibody [NBP2-13903] -Analysis in human cell line U-2 OS and human cell line CACO-2.](http://images.novusbio.com/fullsize/antibody/nbp2-13903_rabbit-polyclonal-ddhd1-antibody-western-blot-2872023104633..jpg "Western Blot: DDHD1 Antibody [NBP2-13903] -Analysis in human cell line U-2 OS and human cell line CACO-2.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")