DDHD1 Antibody

Images

 
Western Blot: DDHD1 Antibody [NBP2-13903] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: DDHD1 Antibody [NBP2-13903] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferus ducts.
Western Blot: DDHD1 Antibody [NBP2-13903] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DDHD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NTAMMREAARKIEERHFSNHATHVEFLPVEWRSKLTLDGDTVDSITPDKV RGLRDMLNSSAMDIMYYTSPLYRDELVKGLQQELNRLYSLFCSRNPD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDHD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DDHD1 Protein (NBP2-13903PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DDHD1 Antibody

  • DDHD domain containing 1
  • DDHD domain-containing protein 1
  • EC 3.1.1.-
  • FLJ34209
  • FLJ42555
  • KIAA1705
  • PA-PLA1
  • Phosphatidic acid-preferring phospholipase A1 homolog
  • phosphatidic acid-preferring phospholipase A1-like protein
  • phospholipase DDHD1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83966
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NLS164
Species: Hu
Applications: IHC, IHC-P
H00009056-B01P
Species: Hu, Rt
Applications: WB
NBP1-32006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58599
Species: Hu
Applications: ICC/IF
NBP2-34078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
21400002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00022908-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76331
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00051062-M03
Species: Hu, Rt
Applications: WB, ELISA
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
H00009420-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for DDHD1 Antibody (NBP2-13903) (0)

There are no publications for DDHD1 Antibody (NBP2-13903).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDHD1 Antibody (NBP2-13903) (0)

There are no reviews for DDHD1 Antibody (NBP2-13903). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DDHD1 Antibody (NBP2-13903) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDHD1 Products

Bioinformatics Tool for DDHD1 Antibody (NBP2-13903)

Discover related pathways, diseases and genes to DDHD1 Antibody (NBP2-13903). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDHD1 Antibody (NBP2-13903)

Discover more about diseases related to DDHD1 Antibody (NBP2-13903).

Research Areas for DDHD1 Antibody (NBP2-13903)

Find related products by research area.

Blogs on DDHD1

There are no specific blogs for DDHD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDHD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDHD1