DCLK1 Antibody (6H4) - Azide and BSA Free

Western Blot: DCLK1 Antibody (6H4) [H00009201-M03] - Analysis of DCAMKL1 expression in NIH/3T3 (Cat # L018V1).

Immunocytochemistry/Immunofluorescence: DCLK1 Antibody (6H4) [H00009201-M03] - Analysis of monoclonal antibody to DCAMKL1 on NIH/3T3 cell. Antibody concentration 10 ug/ml

ELISA: DCLK1 Antibody (6H4) [H00009201-M03] - Detection limit for recombinant GST tagged DCLK1 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF
• Clone: 6H4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DCLK1 Antibody (6H4) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse DCLK1 Antibody (6H4) - Azide and BSA Free (H00009201-M03) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: DCAMKL1 (NP_004725, 640 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM
• Specificity: DCAMKL1 (6H4)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DCLK1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DCLK1 Antibody (6H4) - Azide and BSA Free

• CL1
• CLICK1
• DCAMKL1
• DCAMKL1CLICK1
• DCDC3A
• DCDC3ACL1
• DCLK
• DCLK1
• doublecortin and CaM kinase-like 1
• Doublecortin domain-containing protein 3A
• doublecortin-like kinase 1Doublecortin-like and CAM kinase-like 1
• EC 2.7.11
• KIAA0369EC 2.7.11.1
• serine/threonine-protein kinase DCLK1

Background

DCAMKL1 is a microtubule-associated protein that phosphorylates itself and myelin basic protein (MBP; MIM 159430). DCAMKL1 has microtubule polymerizing activity that is independent of its protein kinase activity (Lin et al., 2000 [PubMed 11124993]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DCLK1
• Entrez:
  • 9201(Human)
• OMIM:
  • 604742(Human)
• Uniprot:
  • NP_004725()