DCAMKL2 Antibody

Images

 
Immunohistochemistry: DCAMKL2 Antibody [NBP1-85282] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry: DCAMKL2 Antibody [NBP1-85282] - Staining of human ovary shows cytoplasmic positivity in follicle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DCAMKL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMNTALDKEGQIFCSKHCQDSGRPGMEPISPVPPSVEEIPVPGEAVPAPTPPESPTPHCPPAAPGGERAG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCLK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DCAMKL2 Protein (NBP1-85282PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DCAMKL2 Antibody

  • CL2EC 2.7.11.1
  • CLICK-II
  • CLIK2
  • DCDC3
  • DCDC3BCaMK-like CREB regulatory kinase 2
  • DCK2DCAMKL2
  • DKFZp761I032
  • doublecortin and CaM kinase-like 2
  • Doublecortin domain-containing protein 3B
  • Doublecortin-like and CAM kinase-like 2
  • doublecortin-like kinase 2CLICK2
  • EC 2.7.11
  • MGC45428
  • serine/threonine-protein kinase DCLK2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77127
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85609
Species: Hu
Applications: IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-27192
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
21890002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
AF1936
Species: Hu
Applications: WB, IP

Publications for DCAMKL2 Antibody (NBP1-85282) (0)

There are no publications for DCAMKL2 Antibody (NBP1-85282).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DCAMKL2 Antibody (NBP1-85282) (0)

There are no reviews for DCAMKL2 Antibody (NBP1-85282). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DCAMKL2 Antibody (NBP1-85282) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DCAMKL2 Products

Bioinformatics Tool for DCAMKL2 Antibody (NBP1-85282)

Discover related pathways, diseases and genes to DCAMKL2 Antibody (NBP1-85282). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DCAMKL2 Antibody (NBP1-85282)

Discover more about diseases related to DCAMKL2 Antibody (NBP1-85282).
 

Pathways for DCAMKL2 Antibody (NBP1-85282)

View related products by pathway.

Research Areas for DCAMKL2 Antibody (NBP1-85282)

Find related products by research area.

Blogs on DCAMKL2

There are no specific blogs for DCAMKL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DCAMKL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCLK2