DBR1 Antibody

Images

 
Western Blot: DBR1 Antibody [NBP1-85907] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: DBR1 Antibody [NBP1-85907] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: DBR1 Antibody [NBP1-85907] - Staining of human gall bladder shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DBR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SALSSINPDEIMLDEEEDEDSIVSAHSGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DBR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DBR1 Protein (NBP1-85907PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DBR1 Antibody

  • debranching enzyme (S. Cerevisiae) homolog 1
  • debranching enzyme homolog 1 (S. cerevisiae)
  • EC 3.1
  • lariat debranching enzyme
  • RNA lariat debranching enzyme

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-57200
Species: Hu
Applications: ICC/IF
NB100-150
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB100-56076
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-P, IP
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-62539
Species: Hu
Applications: WB
NBP2-16064
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7766
Species: Hu
Applications: WB, IHC
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-31354
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4345
Species: Hu, Mu, Rt
Applications: WB
AF4344
Species: Hu
Applications: WB
NBP1-85907
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DBR1 Antibody (NBP1-85907) (0)

There are no publications for DBR1 Antibody (NBP1-85907).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DBR1 Antibody (NBP1-85907) (0)

There are no reviews for DBR1 Antibody (NBP1-85907). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DBR1 Antibody (NBP1-85907) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DBR1 Products

Bioinformatics Tool for DBR1 Antibody (NBP1-85907)

Discover related pathways, diseases and genes to DBR1 Antibody (NBP1-85907). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DBR1 Antibody (NBP1-85907)

Discover more about diseases related to DBR1 Antibody (NBP1-85907).
 

Pathways for DBR1 Antibody (NBP1-85907)

View related products by pathway.

PTMs for DBR1 Antibody (NBP1-85907)

Learn more about PTMs related to DBR1 Antibody (NBP1-85907).

Blogs on DBR1

There are no specific blogs for DBR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DBR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DBR1