DAZAP2 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DAZAP2. Peptide sequence: AGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTI The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DAZAP2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for DAZAP2 Antibody - BSA Free
Background
DAZAP2, also known as DAZ-associated protein2, consists of five isoforms of sizes 17.3 kDa, 16.1 kDa, 14 kDa, 9 kDa, and 22.8 kDa and is involved in interactions with DAZ proteins and transforming growth factor signaling molecules. This protein is being studied for connection to disorders and diseases such as multiple myeloma, brachydactyly, ataxia, prostatitis, and azoospermia. The protein interacts in pathways including cell signaling, transcription regulation, spermatogenesis, and RNA splicing, which also involve POLI, RHOXF2, BATF2, EXD3, and ZFAND2B proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PCR, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Ca, Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Ca, Ch, Hu, Mu, Pm
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Publications for DAZAP2 Antibody (NBP2-87246) (0)
There are no publications for DAZAP2 Antibody (NBP2-87246).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DAZAP2 Antibody (NBP2-87246) (0)
There are no reviews for DAZAP2 Antibody (NBP2-87246).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DAZAP2 Antibody (NBP2-87246) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DAZAP2 Products
Blogs on DAZAP2