DAP3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

DAP3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DAP3.
  
  

  Source: E. coli

  Amino Acid Sequence: GSPLGEVVEQGITRVRNATDAVGIVLKELKRQSSLGMFHLLVAVDGINALWGRTTLKREDKSPIAPEELALVHNLRKMMKNDWHGGAIVSALSQTGSLFKPRKAYLPQELLGKEGFDALDPFIPILVSNYNPKEF

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: DAP3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88568.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DAP3 Recombinant Protein Antigen

• bMRP-10
• DAP-3Death-associated protein 3
• death associated protein 3
• DKFZp686G12159,28S ribosomal protein S29, mitochondrial
• FLJ12817
• MGC126058
• MGC126059
• mitochondrial 28S ribosomal protein S29
• MRP-S29Ionizing radiation resistance conferring protein
• MRPS29S29mt

Background

Death Associated Protein 3 (DAP3) is a 46 kDa protein carrying a potential nucleotide binding motif (P-loop) at its N-terminal region. The protein is widely expressed, and the expression is upregulated during membrane-receptor mediated apoptosis. In interferon-gamma and Fas induced apoptosis, DAP3 acts as a positive mediator by functioning downstream of the receptor signaling complex and upstream of the effector caspases. However, the mechanism for its function is largely unknown. Interestingly, the N-terminal 230 amino acid fragment of DAP3 alone protects cells from Fas induced cell death. The same region of DAP3 also serves as a binding site for the glucocorticoid receptor and mediates receptor functions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: DAP3