DAN/NBL1 Recombinant Protein Antigen

Images

 
There are currently no images for DAN/NBL1 Protein (NBP1-85340PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DAN/NBL1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NBL1.

Source: E. coli

Amino Acid Sequence: PPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NBL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85340.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DAN/NBL1 Recombinant Protein Antigen

  • DAN domain family member 1
  • DAN
  • DAND1
  • MGC8972
  • NBL1
  • neuroblastoma suppressor of tumorigenicity 1
  • neuroblastoma, suppression of tumorigenicity 1
  • Protein N03
  • suppression of tumorigenicity 1
  • Zinc finger protein DAN

Background

NBL1 product is the founding member of the evolutionarily conserved CAN (Cerberus and DAN) family of proteins, which contain a domain resembling the CTCK (C-terminal cystine knot-like) motif found in a number of signaling molecules. These proteins are secreted, and act as BMP (bone morphogenetic protein) antagonists by binding to BMPs and preventing them from interacting with their receptors. They may thus play an important role during growth and development. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1106
Species: Hu
Applications: IP, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF2009
Species: Hu
Applications: ICC, IHC
NB200-109
Species: Hu, Mu
Applications: ChIP, ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
NBP2-67605
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, ISH, WB
NBP1-88220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-83790
Species: Hu
Applications: IHC,  IHC-P, WB
MAB2772
Species: Hu, Pm
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC,  IHC-P, MI, WB
NB600-534
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, In vivo, RIA, WB
NBP1-87581
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-62693
Species: Hu
Applications: IHC,  IHC-P
NB100-59787
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, PLA, WB
MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-48002
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF956
Species: Hu, Mu
Applications: Block, IHC
AF2069
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
AF1056
Species: Rt
Applications: IHC, WB

Publications for DAN/NBL1 Protein (NBP1-85340PEP) (0)

There are no publications for DAN/NBL1 Protein (NBP1-85340PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAN/NBL1 Protein (NBP1-85340PEP) (0)

There are no reviews for DAN/NBL1 Protein (NBP1-85340PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DAN/NBL1 Protein (NBP1-85340PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DAN/NBL1 Products

Research Areas for DAN/NBL1 Protein (NBP1-85340PEP)

Find related products by research area.

Blogs on DAN/NBL1

There are no specific blogs for DAN/NBL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DAN/NBL1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NBL1