DACT3/Dapper 3 Antibody


Immunocytochemistry/ Immunofluorescence: DACT3/Dapper 3 Antibody [NBP1-81196] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: DACT3/Dapper 3 Antibody [NBP1-81196] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

DACT3/Dapper 3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ALEEQLEALPGLVWDLGQQLGDLSLESGGLEQESGRSSGFYEDPSSTGGPDSPPSTFCGDSGFSGSSSYGRLGPSEP
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DACT3/Dapper 3 Protein (NBP1-81196PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DACT3/Dapper 3 Antibody

  • Antagonist of beta-catenin Dapper homolog 3
  • arginine rich region 1
  • Arginine-rich region 1 protein
  • DACT3
  • Dapper 3
  • dapper homolog 3
  • dapper, antagonist of beta-catenin, homolog 3 (Xenopus laevis)
  • MGC15476
  • RRR1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Ch, Hu, Mu, Pm, Rt, Xp, Ze
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for DACT3/Dapper 3 Antibody (NBP1-81196) (0)

There are no publications for DACT3/Dapper 3 Antibody (NBP1-81196).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DACT3/Dapper 3 Antibody (NBP1-81196) (0)

There are no reviews for DACT3/Dapper 3 Antibody (NBP1-81196). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DACT3/Dapper 3 Antibody (NBP1-81196) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional DACT3/Dapper 3 Products

Bioinformatics Tool for DACT3/Dapper 3 Antibody (NBP1-81196)

Discover related pathways, diseases and genes to DACT3/Dapper 3 Antibody (NBP1-81196). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DACT3/Dapper 3 Antibody (NBP1-81196)

Discover more about diseases related to DACT3/Dapper 3 Antibody (NBP1-81196).

Pathways for DACT3/Dapper 3 Antibody (NBP1-81196)

View related products by pathway.

PTMs for DACT3/Dapper 3 Antibody (NBP1-81196)

Learn more about PTMs related to DACT3/Dapper 3 Antibody (NBP1-81196).

Blogs on DACT3/Dapper 3

There are no specific blogs for DACT3/Dapper 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DACT3/Dapper 3 Antibody and receive a gift card or discount.


Gene Symbol DACT3