![Western Blot: DAB1 Antibody - Azide and BSA Free [NBP2-92015] - Western blot analysis of various lysates using DAB1 Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.](http://images.novusbio.com/fullsize/nbp2-92015_rabbit-polyclonal-dab1-antibody-42202514275283.jpg "Western Blot: DAB1 Antibody - Azide and BSA Free [NBP2-92015] - Western blot analysis of various lysates using DAB1 Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit DAB1 Antibody - Azide and BSA Free (NBP2-92015) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human DAB1 (NP_066566.3). MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DAB1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for DAB1 Antibody (NBP2-92015)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DAB1 |
![Immunocytochemistry/ Immunofluorescence: DAB1 Antibody - Azide and BSA Free [NBP2-92015] - Immunofluorescence analysis of SH-SY5Y cells using DAB1 Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-92015_rabbit-polyclonal-dab1-antibody-42202514264429.jpg "Immunocytochemistry/ Immunofluorescence: DAB1 Antibody - Azide and BSA Free [NBP2-92015] - Immunofluorescence analysis of SH-SY5Y cells using DAB1 Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunohistochemistry Reelin Antibody [Unconjugated]](https://images.novusbio.com/images2/Reelin_AF3820_Immunohistochemistry_18505.jpg)
![Immunohistochemistry VLDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/VLDL_R_AF2258_Immunohistochemistry_22497.jpg)
![Immunohistochemistry VLDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/VLDL_R_AF2258_Immunohistochemistry_9765.jpg)
![Western Blot VLDLR Antibody [Unconjugated]](https://images.novusbio.com/images/af2258_mouse-vldl-r-affinity-purified-polyclonal-ab-western-blot-12122025825243.jpg)
![Western Blot Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Western_Blot_5334.jpg)
![Immunohistochemistry Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Immunohistochemistry_10404.jpg)
![Simple Western Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Simple_Western_16649.jpg)
![SDS-PAGE IL-12 [Unconjugated]](https://images.novusbio.com/images2/IL-12_419-ML_403.jpg)
![Bioactivity IL-12 [Unconjugated]](https://images.novusbio.com/images2/IL-12_419-ML_405.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")