Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody

Images

 
Western Blot: Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody [NBP1-81770] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: ...read more
Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody [NBP1-81770] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody [NBP1-81770] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody [NBP1-81770] - Staining in human cerebral cortex and tonsil tissues using anti-SULT4A1 antibody. Corresponding SULT4A1 RNA-seq data are ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSL
Specificity
Specificity of human Cytosolic Sulfotransferase 4A1/SULT4A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SULT4A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cytosolic Sulfotransferase 4A1/SULT4A1 Protein (NBP1-81770PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody

  • Brain sulfotransferase-like protein
  • BRSTL1
  • BR-STL-1
  • Cytosolic Sulfotransferase 4A1
  • EC 2.8.2.-
  • hBR-STL
  • hBR-STL-1MGC40032
  • nervous system cytosolic sulfotransferase
  • Nervous system sulfotransferase
  • NST
  • ST4A1
  • sulfotransferase 4A1
  • sulfotransferase family 4A, member 1
  • sulfotransferase-related protein
  • SULT4A1
  • SULTX3
  • SULTX3DJ388M5.3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1619
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-14344
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00010559-P01
Species: Hu
NBP1-86617
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85431
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF5486
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
H00008706-P01
Species: Hu
NBP2-45825
Species: Hu
Applications: WB, IHC
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-81770
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (NBP1-81770) (0)

There are no publications for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (NBP1-81770).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (NBP1-81770) (0)

There are no reviews for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (NBP1-81770). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (NBP1-81770) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (NBP1-81770)

Discover related pathways, diseases and genes to Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (NBP1-81770). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (NBP1-81770)

Discover more about diseases related to Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (NBP1-81770).
 

Pathways for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (NBP1-81770)

View related products by pathway.

PTMs for Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (NBP1-81770)

Learn more about PTMs related to Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody (NBP1-81770).

Blogs on Cytosolic Sulfotransferase 4A1/SULT4A1

There are no specific blogs for Cytosolic Sulfotransferase 4A1/SULT4A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytosolic Sulfotransferase 4A1/SULT4A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SULT4A1
Entrez