Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody

Images

 
Western Blot: Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody [H00006818-B01P] - Analysis of SULT1A3 expression in human liver.
Western Blot: Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody [H00006818-B01P] - Analysis of SULT1A3 expression in HepG2.
Western Blot: Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody [H00006818-B01P] - Analysis of SULT1A3 expression in transfected 293T cell line by SULT1A3 polyclonal antibody. Lane 1: SULT1A3 transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody Summary

Immunogen
SULT1A3 (AAH14471, 1 a.a. - 295 a.a.) full-length human protein. MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SULT1A3
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody

  • Cytosolic Sulfotransferase 1A3
  • EC 2.8.2
  • EC 2.8.2.1
  • HAST
  • HAST3
  • M form) phenol sulfotransferase
  • MGC117469
  • Monoamine-sulfating phenol sulfotransferase
  • M-PST
  • ST1A3/ST1A4
  • STM
  • sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3
  • Sulfotransferase, monoamine-preferring
  • SULT1A3
  • Thermolabile phenol sulfotransferase
  • TL-PST

Background

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a phenol sulfotransferase with thermolabile enzyme activity. Four sulfotransferase genes are located on the p arm of chromosome 16; this gene and SULT1A4 arose from a segmental duplication. This gene is the most centromeric of the four sulfotransferase genes. Exons of this gene overlap with exons of a gene that encodes a protein containing GIY-YIG domains (GIYD1). Three alternatively spliced variants that encode the same protein have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
MAB5545
Species: Hu
Applications: WB
AF5828
Species: Hu
Applications: WB, ICC, Neut
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NBP2-58463
Species: Hu
Applications: WB, ICC/IF
NBP1-86856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP1-69668
Species: Hu
Applications: WB
NBP2-31904
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86995
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00006818-B01P
Species: Hu
Applications: WB

Publications for Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody (H00006818-B01P) (0)

There are no publications for Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody (H00006818-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody (H00006818-B01P) (0)

There are no reviews for Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody (H00006818-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody (H00006818-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Products

Bioinformatics Tool for Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody (H00006818-B01P)

Discover related pathways, diseases and genes to Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody (H00006818-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody (H00006818-B01P)

Discover more about diseases related to Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody (H00006818-B01P).
 

Pathways for Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody (H00006818-B01P)

View related products by pathway.

PTMs for Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody (H00006818-B01P)

Learn more about PTMs related to Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody (H00006818-B01P).

Blogs on Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS

There are no specific blogs for Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytosolic Sulfotransferase 1A3/SULT1A3/CSPS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SULT1A3
Entrez
Uniprot