Cytokeratin 75 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KRT75. Source: E. coli
Amino Acid Sequence: MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRISSA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
KRT75 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87845. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Cytokeratin 75 Recombinant Protein Antigen
Background
Keratin-75 is a protein that plays a central role in hair and nail formation, as it is an important component of the keratin intermediate filaments that are located in the companion layer of the hair follicle, and is 551 amino acids long with a weight of approximately 60 kDa. Studies are being conducted on diseases and disorders related to this protein including loose anagen hair syndrome, pseudofolliculitis barbae, histocytoma, Marek disease, dermatitis, alopecia, pharyngitis, lung cancer, breast cancer, esophagitis, hepatitis, and neuronitis. Keratin-75 has also been shown to have interactions with GABARAP, GABARAPL1, MAP1LC3A, MAR1LC3B, and AMBRA1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Bv, Gt, Hu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: PEP-ELISA, WB
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IM, IP, Simple Western, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu
Applications: AC
Publications for Cytokeratin 75 Protein (NBP1-87845PEP) (0)
There are no publications for Cytokeratin 75 Protein (NBP1-87845PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cytokeratin 75 Protein (NBP1-87845PEP) (0)
There are no reviews for Cytokeratin 75 Protein (NBP1-87845PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Cytokeratin 75 Protein (NBP1-87845PEP) (0)
Additional Cytokeratin 75 Products
Blogs on Cytokeratin 75