Cytokeratin 75 Recombinant Protein Antigen

Images

 
There are currently no images for Cytokeratin 75 Protein (NBP1-87845PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cytokeratin 75 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KRT75.

Source: E. coli

Amino Acid Sequence: MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRISSA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KRT75
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87845.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cytokeratin 75 Recombinant Protein Antigen

  • CK-75
  • cytokeratin-75
  • hK6hf
  • K6HFcytokeratin type II
  • K75
  • KB18
  • keratin 75
  • keratin, type II cytoskeletal 75
  • Keratin-6 hair follicle
  • keratin-75
  • PFB
  • type II keratin-18
  • Type II keratin-K6hf
  • Type-II keratin Kb18

Background

Keratin-75 is a protein that plays a central role in hair and nail formation, as it is an important component of the keratin intermediate filaments that are located in the companion layer of the hair follicle, and is 551 amino acids long with a weight of approximately 60 kDa. Studies are being conducted on diseases and disorders related to this protein including loose anagen hair syndrome, pseudofolliculitis barbae, histocytoma, Marek disease, dermatitis, alopecia, pharyngitis, lung cancer, breast cancer, esophagitis, hepatitis, and neuronitis. Keratin-75 has also been shown to have interactions with GABARAP, GABARAPL1, MAP1LC3A, MAR1LC3B, and AMBRA1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89985
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NBP2-29421
Species: Bv, Gt, Hu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-68864
Species: Mu
Applications: PEP-ELISA, WB
NBP3-25721
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67559
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IM, IP, Simple Western, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC,  IHC-P, MI, WB
AF8216
Species: Hu, Mu, Rt
Applications: WB
AF3468
Species: Hu
Applications: ICC, KO, Simple Western, WB
NBP2-61931
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
664-LI
Species: Hu
Applications: BA
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC,  IHC-P, WB

Publications for Cytokeratin 75 Protein (NBP1-87845PEP) (0)

There are no publications for Cytokeratin 75 Protein (NBP1-87845PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 75 Protein (NBP1-87845PEP) (0)

There are no reviews for Cytokeratin 75 Protein (NBP1-87845PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cytokeratin 75 Protein (NBP1-87845PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cytokeratin 75 Products

Blogs on Cytokeratin 75

There are no specific blogs for Cytokeratin 75, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cytokeratin 75 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT75