Cytokeratin 7 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cytokeratin 7. Source: E. coli Amino Acid Sequence: RQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G). Source: E. coli Amino Acid Sequence: RQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
KRT7 |
| Purity |
>80% SDS-PAGE |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-88918. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Packaging, Storage & Formulations
| Storage |
Store at -20 degrees C. Avoid freeze/thaw cycles. |
| Buffer |
PBS, 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% SDS-PAGE |
Alternate Names for Cytokeratin 7 Recombinant Protein Antigen
Background
Cytokeratin 7 is a 54kD intermediate filament protein found in a variety of glandularepithelia. Cytokeratin 7 has been found in columnar and glandular epithelium of the lung, cervix, breast, bile ducts and larger collecting ducts of the kidney. It is present in the transitional epithelium of bladder as well as ovarian and lungepithelia, and occasionally staining of blood vessel cell walls, particularly endothelial cells, may be observed. However, Cytokeratin 7 is not expressed by epithelial cells of the gastrointestinal tract, colon or prostate. Keratin 7 is often co expressed with keratin 19.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, KO, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for Cytokeratin 7 Recombinant Protein Antigen (NBP2-88918PEP) (0)
There are no publications for Cytokeratin 7 Recombinant Protein Antigen (NBP2-88918PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cytokeratin 7 Recombinant Protein Antigen (NBP2-88918PEP) (0)
There are no reviews for Cytokeratin 7 Recombinant Protein Antigen (NBP2-88918PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Cytokeratin 7 Recombinant Protein Antigen (NBP2-88918PEP) (0)
Additional Cytokeratin 7 Products
Research Areas for Cytokeratin 7 Recombinant Protein Antigen (NBP2-88918PEP)
Find related products by research area.
|
Blogs on Cytokeratin 7