Cytokeratin 12 Antibody

Images

 
Immunohistochemistry-Paraffin: Cytokeratin 12 Antibody [NBP2-58256] - Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Cytokeratin 12 Antibody [NBP2-58256] - Staining of human eye shows strong cytoplasmic positivity in the corneal epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytokeratin 12 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QGDGLEESLFVTDSKSQAQSTDSSKDPTKTRK
Specificity
Specificity of human Cytokeratin 12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRT12
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cytokeratin 12 Recombinant Protein Antigen (NBP2-58256PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Cytokeratin 12 Antibody

  • keratin, type I cytoskeletal 12
  • K12
  • keratin 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34844
Species: Hu, Mu, Bv, Rb
Applications: WB, IHC-Fr, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-14144
Species: Hu
Applications: IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
AF1916
Species: Hu
Applications: WB, IHC, ICC
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, ICC
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00008706-P01
Species: Hu
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-07996
Species: Hu
NBP2-52487
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NB110-56916
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Cytokeratin 12 Antibody (NBP2-58256) (0)

There are no publications for Cytokeratin 12 Antibody (NBP2-58256).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 12 Antibody (NBP2-58256) (0)

There are no reviews for Cytokeratin 12 Antibody (NBP2-58256). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cytokeratin 12 Antibody (NBP2-58256) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Cytokeratin 12 Antibody (NBP2-58256)

Discover related pathways, diseases and genes to Cytokeratin 12 Antibody (NBP2-58256). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytokeratin 12 Antibody (NBP2-58256)

Discover more about diseases related to Cytokeratin 12 Antibody (NBP2-58256).
 

Pathways for Cytokeratin 12 Antibody (NBP2-58256)

View related products by pathway.

Blogs on Cytokeratin 12

There are no specific blogs for Cytokeratin 12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytokeratin 12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT12