Novus Biologicals products are now on bio-techne.com

Cytohesin 4 Antibody

Images

 
Immunohistochemistry: Cytohesin 4 Antibody [NBP2-49664] - Staining of human spleen shows cytoplasmic positivity in lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytohesin 4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYTH4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cytohesin 4 Recombinant Protein Antigen (NBP2-49664PEP)

Reactivity Notes

Mouse (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytohesin 4 Antibody

  • CYT4PH, SEC7 and coiled-coil domain-containing protein 4
  • cytohesin 4
  • cytohesin-4
  • pleckstrin homology, Sec7 and coiled/coil domains 4
  • pleckstrin homology, Sec7 and coiled-coil domains 4
  • PSCD4DJ63G5.1

Background

Pleckstrin homology, Sec7 and coiled/coil domains 4 (PSCD4) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The PSCD4 exhibits GEP activity in vitro with both ARF1 and ARF5 but is inactive with ARF6. The PSCD4 and PSCD1 gene structures are very similar.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22513
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00009266-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
H00009265-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-41263
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00005662-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
NBP2-81958
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-29906
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP3-03329
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
1137-SL
Species: Hu
Applications: BA
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
NBP2-46421
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-25200
Species: Hu
Applications: B/N, Flow, IHC, IHC-Fr, WB
H00000381-M01
Species: Ba, Ca, Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NLS418
Species: Hu
Applications: IHC, IHC-P
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37364
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP2-49664
Species: Hu
Applications: IHC

Publications for Cytohesin 4 Antibody (NBP2-49664) (0)

There are no publications for Cytohesin 4 Antibody (NBP2-49664).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytohesin 4 Antibody (NBP2-49664) (0)

There are no reviews for Cytohesin 4 Antibody (NBP2-49664). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cytohesin 4 Antibody (NBP2-49664) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytohesin 4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYTH4