Cytohesin 4 Antibody - BSA Free

Immunohistochemistry: Cytohesin 4 Antibody [NBP2-49664] - Staining of human spleen shows cytoplasmic positivity in lymphoid cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cytohesin 4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cytohesin 4 Antibody - BSA Free (NBP2-49664) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CYTH4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Cytohesin 4 Recombinant Protein Antigen (NBP2-49664PEP)

Reactivity Notes

Mouse (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cytohesin 4 Antibody - BSA Free

• CYT4PH, SEC7 and coiled-coil domain-containing protein 4
• cytohesin 4
• cytohesin-4
• pleckstrin homology, Sec7 and coiled/coil domains 4
• pleckstrin homology, Sec7 and coiled-coil domains 4
• PSCD4DJ63G5.1

Background

Pleckstrin homology, Sec7 and coiled/coil domains 4 (PSCD4) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The PSCD4 exhibits GEP activity in vitro with both ARF1 and ARF5 but is inactive with ARF6. The PSCD4 and PSCD1 gene structures are very similar.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CYTH4