Cytohesin 4 Antibody


Western Blot: Cytohesin 4 Antibody [NBP1-56913] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Cytohesin 4 Antibody Summary

Synthetic peptides corresponding to PSCD4(pleckstrin homology, Sec7 and coiled-coil domains 4) The peptide sequence was selected from the N terminal of PSCD4. Peptide sequence NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PSCD4 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cytohesin 4 Antibody

  • CYT4PH, SEC7 and coiled-coil domain-containing protein 4
  • cytohesin 4
  • cytohesin-4
  • pleckstrin homology, Sec7 and coiled/coil domains 4
  • pleckstrin homology, Sec7 and coiled-coil domains 4
  • PSCD4DJ63G5.1


PSCD4 promotes guanine-nucleotide exchange on ARF1 and ARF5. PSCD4 promotes the activation of ARF through replacement of GDP with GTP.Pleckstrin homology, Sec7 and coiled/coil domains 4 (PSCD4) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The PSCD4 exhibits GEP activity in vitro with both ARF1 and ARF5 but is inactive with ARF6. The PSCD4 and PSCD1 gene structures are very similar.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB (-), WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, B/N, Flow, IHC, IHC-Fr
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC, ICC
Species: Hu
Applications: WB

Publications for Cytohesin 4 Antibody (NBP1-56913) (0)

There are no publications for Cytohesin 4 Antibody (NBP1-56913).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytohesin 4 Antibody (NBP1-56913) (0)

There are no reviews for Cytohesin 4 Antibody (NBP1-56913). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytohesin 4 Antibody (NBP1-56913) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Cytohesin 4 Antibody (NBP1-56913)

Discover related pathways, diseases and genes to Cytohesin 4 Antibody (NBP1-56913). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytohesin 4 Antibody (NBP1-56913)

Discover more about diseases related to Cytohesin 4 Antibody (NBP1-56913).

Pathways for Cytohesin 4 Antibody (NBP1-56913)

View related products by pathway.

PTMs for Cytohesin 4 Antibody (NBP1-56913)

Learn more about PTMs related to Cytohesin 4 Antibody (NBP1-56913).

Blogs on Cytohesin 4

There are no specific blogs for Cytohesin 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cytohesin 4 Antibody and receive a gift card or discount.


Gene Symbol CYTH4