Cytohesin 4 Antibody - Azide and BSA Free

Western Blot: Cytohesin 4 Antibody [H00027128-B01P] - Analysis of PSCD4 expression in human spleen.

Western Blot: Cytohesin 4 Antibody [H00027128-B01P] - Analysis of CYTH4 expression in transfected 293T cell line by CYTH4 polyclonal antibody. Lane 1: PSCD4 transfected lysate(43.34 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Cytohesin 4 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Cytohesin 4 Antibody - Azide and BSA Free (H00027128-B01P) is a polyclonal antibody validated for use in WB. Anti-Cytohesin 4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: CYTH4 (NP_037517.1, 1 a.a. - 394 a.a.) full-length human protein. MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQKEKELCIGRKKFNMDPAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCLCNPGVFQSTDTCYVLSFSIIMLNTSLHNPNVRDRPPFERFVSMNRGINNGSDLPEDQLRNLFDSIKSEPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTTDKEPRGIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESYRISATSAEERDQWIESIRASITRVPFYDLVSTRKKKIASKQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CYTH4
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is useful for Western Blot

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytohesin 4 Antibody - Azide and BSA Free

• CYT4PH, SEC7 and coiled-coil domain-containing protein 4
• cytohesin 4
• cytohesin-4
• pleckstrin homology, Sec7 and coiled/coil domains 4
• pleckstrin homology, Sec7 and coiled-coil domains 4
• PSCD4DJ63G5.1

Background

Pleckstrin homology, Sec7 and coiled/coil domains 4 (PSCD4) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The PSCD4 exhibits GEP activity in vitro with both ARF1 and ARF5 but is inactive with ARF6. The PSCD4 and PSCD1 gene structures are very similar.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cytohesin 4 Antibody (H00027128-B01P)(1)

Publication using H00027128-B01P

• Hong Wang, Yishu Xiao, Wei Zhou, Yonghui Li Integrated analysis and validation reveal CYTH4 as a potential prognostic biomarker in acute myeloid leukemia Oncology Letters 2024-03-01 [PMID: 38298432]

Bioinformatics

• Gene Symbol: CYTH4
• Uniprot:
  • NP_037517.1(Human)