Cytoglobin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Cytoglobin Antibody [NBP2-55897] - Staining of human cell line SH-SY5Y shows localization to nuclear speckles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytoglobin Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDV
Specificity
Specificity of human Cytoglobin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYGB
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Cytoglobin Antibody

  • cytoglobin
  • HGBHistoglobin
  • histoglobin
  • STAPHGb
  • Stellate cell activation-associated protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48769
Species: Hu
Applications: IHC, IHC-P
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85454
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88115
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-57697
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Ft, Mk, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KO, LA
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-269
Species: Hu, Mu, Rt, Po, Bv, Ce, Ch, Dr, Eq, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-WhMt, KD
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55897
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for Cytoglobin Antibody (NBP2-55897) (0)

There are no publications for Cytoglobin Antibody (NBP2-55897).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytoglobin Antibody (NBP2-55897) (0)

There are no reviews for Cytoglobin Antibody (NBP2-55897). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cytoglobin Antibody (NBP2-55897) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Cytoglobin Products

Bioinformatics Tool for Cytoglobin Antibody (NBP2-55897)

Discover related pathways, diseases and genes to Cytoglobin Antibody (NBP2-55897). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytoglobin Antibody (NBP2-55897)

Discover more about diseases related to Cytoglobin Antibody (NBP2-55897).
 

Pathways for Cytoglobin Antibody (NBP2-55897)

View related products by pathway.

PTMs for Cytoglobin Antibody (NBP2-55897)

Learn more about PTMs related to Cytoglobin Antibody (NBP2-55897).

Blogs on Cytoglobin

There are no specific blogs for Cytoglobin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytoglobin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYGB