![Western Blot: Cytochrome P450 3A4/3A5 Antibody [NBP1-69667] - This Anti-CYP3A4 antibody was used in Western Blot of THP-1 tissue lysate at a concentration of 1ug/ml.](http://images.novusbio.com/fullsize/Cytochrome-P450-3A4-3A5-Antibody-Western-Blot-NBP1-69667-img0001.jpg "Western Blot: Cytochrome P450 3A4/3A5 Antibody [NBP1-69667] - This Anti-CYP3A4 antibody was used in Western Blot of THP-1 tissue lysate at a concentration of 1ug/ml.")
| Immunogen | Synthetic peptides corresponding to CYP3A4(cytochrome P450, family 3, subfamily A, polypeptide 4) The peptide sequence was selected from the middle region of CYP3A4 (NP_059488).
Peptide sequence MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CYP3A4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 57 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Cytochrome P450 3A4/3A5 Antibody (NBP1-69667)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
