Cytochrome P450 3A4/3A5 Antibody


Western Blot: Cytochrome P450 3A4/3A5 Antibody [NBP1-69667] - This Anti-CYP3A4 antibody was used in Western Blot of THP-1 tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Cytochrome P450 3A4/3A5 Antibody Summary

Synthetic peptides corresponding to CYP3A4(cytochrome P450, family 3, subfamily A, polypeptide 4) The peptide sequence was selected from the middle region of CYP3A4 (NP_059488). Peptide sequence MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cytochrome P450 3A4/3A5 Antibody

  • Albendazole monooxygenase
  • Albendazole sulfoxidase
  • CP33
  • CP34
  • CYP3A
  • CYP3A3
  • Cytochrome P450 3A3
  • cytochrome P450 3A4
  • Cytochrome P450 HLp
  • Cytochrome P450 NF-25
  • cytochrome P450, family 3, subfamily A, polypeptide 4
  • cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 3
  • cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4
  • Cytochrome P450-PCN1
  • EC
  • EC
  • EC
  • EC
  • glucocorticoid-inducible P450
  • HLP
  • MGC126680
  • NF-25
  • Nifedipine oxidase
  • P450C3
  • P450-III, steroid inducible
  • P450PCN1
  • Quinine 3-monooxygenase
  • Taurochenodeoxycholate 6-alpha-hydroxylase


This gene, CYP3A4, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This prot


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ba
Applications: WB, ICC/IF, IHC
Species: Hu
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
Species: Hu
Applications: WB

Publications for Cytochrome P450 3A4/3A5 Antibody (NBP1-69667) (0)

There are no publications for Cytochrome P450 3A4/3A5 Antibody (NBP1-69667).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytochrome P450 3A4/3A5 Antibody (NBP1-69667) (0)

There are no reviews for Cytochrome P450 3A4/3A5 Antibody (NBP1-69667). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome P450 3A4/3A5 Antibody (NBP1-69667) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Cytochrome P450 3A4/3A5 Products

Cytochrome P450 3A4/3A5 NBP1-69667

Bioinformatics Tool for Cytochrome P450 3A4/3A5 Antibody (NBP1-69667)

Discover related pathways, diseases and genes to Cytochrome P450 3A4/3A5 Antibody (NBP1-69667). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome P450 3A4/3A5 Antibody (NBP1-69667)

Discover more about diseases related to Cytochrome P450 3A4/3A5 Antibody (NBP1-69667).

Pathways for Cytochrome P450 3A4/3A5 Antibody (NBP1-69667)

View related products by pathway.

PTMs for Cytochrome P450 3A4/3A5 Antibody (NBP1-69667)

Learn more about PTMs related to Cytochrome P450 3A4/3A5 Antibody (NBP1-69667).

Research Areas for Cytochrome P450 3A4/3A5 Antibody (NBP1-69667)

Find related products by research area.

Blogs on Cytochrome P450 3A4/3A5

There are no specific blogs for Cytochrome P450 3A4/3A5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cytochrome P450 3A4/3A5 Antibody and receive a gift card or discount.


Gene Symbol CYP3A4