Recombinant Human Cytochrome P450 1A2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cytochrome P450 1A2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human CYP1A2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQEKIVNL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CYP1A2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00001544-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cytochrome P450 1A2 Protein

  • aryl hydrocarbon hydroxylase
  • CP12
  • CYPIA2
  • Cytochrome P(3)450
  • cytochrome P450 1A2
  • Cytochrome P450 4
  • cytochrome P450, family 1, subfamily A, polypeptide 2
  • cytochrome P450, subfamily I (aromatic compound-inducible), polypeptide 2
  • Cytochrome P450-P3
  • dioxin-inducible P3-450
  • EC 1.14.14.1
  • flavoprotein-linked monooxygenase
  • microsomal monooxygenase
  • P3-450
  • P450 form 4
  • P450(PA)
  • xenobiotic monooxygenase

Background

CYP1A2 - cytochrome P450, family 1, subfamily A, polypeptide 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85488
Species: Hu
Applications: WB, IHC, IHC-P
H00057491-R01
Species: Hu
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NBP2-16078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29875
Species: Mu, Rt
Applications: WB
NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-92167
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29917
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-59786
Species: Hu
Applications: WB

Publications for Cytochrome P450 1A2 Partial Recombinant Protein (H00001544-Q01)(1)

Reviews for Cytochrome P450 1A2 Partial Recombinant Protein (H00001544-Q01) (0)

There are no reviews for Cytochrome P450 1A2 Partial Recombinant Protein (H00001544-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome P450 1A2 Partial Recombinant Protein (H00001544-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cytochrome P450 1A2 Products

Bioinformatics Tool for Cytochrome P450 1A2 Partial Recombinant Protein (H00001544-Q01)

Discover related pathways, diseases and genes to Cytochrome P450 1A2 Partial Recombinant Protein (H00001544-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome P450 1A2 Partial Recombinant Protein (H00001544-Q01)

Discover more about diseases related to Cytochrome P450 1A2 Partial Recombinant Protein (H00001544-Q01).
 

Pathways for Cytochrome P450 1A2 Partial Recombinant Protein (H00001544-Q01)

View related products by pathway.

PTMs for Cytochrome P450 1A2 Partial Recombinant Protein (H00001544-Q01)

Learn more about PTMs related to Cytochrome P450 1A2 Partial Recombinant Protein (H00001544-Q01).
 

Research Areas for Cytochrome P450 1A2 Partial Recombinant Protein (H00001544-Q01)

Find related products by research area.

Blogs on Cytochrome P450 1A2

There are no specific blogs for Cytochrome P450 1A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

AHR Antibody
NB100-128
CYP1B1 Antibody
NBP2-24722

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cytochrome P450 1A2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP1A2