Recombinant Human Cysteinyl Leukotriene R1/CysLTR1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cysteinyl Leukotriene R1/CysLTR1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 248-337 of Human CYSLTR1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV

Protein/Peptide Type
Partial Recombinant Protein
Gene
CYSLTR1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cysteinyl Leukotriene R1/CysLTR1 Protein

  • CysLT(1)
  • CysLT1
  • CYSLT1CysLT1
  • CYSLT1R
  • CYSLTR
  • CysLTR1
  • Cysteinyl leukotriene D4 receptor
  • Cysteinyl Leukotriene R1
  • cysteinyl leukotriene receptor 1
  • Cysteinyl LeukotrieneR1
  • G-protein coupled receptor HG55
  • HG55
  • HMTMF81
  • LTD4 Receptor
  • MGC46139

Background

CYSLTR1 - cysteinyl leukotriene receptor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP1-69315
Species: Hu
Applications: WB
NB300-891
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP2-27422
Species: Hu, Pm
Applications: WB, IHC-P
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-47829
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-84943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready

Publications for Cysteinyl Leukotriene R1/CysLTR1 Partial Recombinant Protein (H00010800-Q01) (0)

There are no publications for Cysteinyl Leukotriene R1/CysLTR1 Partial Recombinant Protein (H00010800-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cysteinyl Leukotriene R1/CysLTR1 Partial Recombinant Protein (H00010800-Q01) (0)

There are no reviews for Cysteinyl Leukotriene R1/CysLTR1 Partial Recombinant Protein (H00010800-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cysteinyl Leukotriene R1/CysLTR1 Partial Recombinant Protein (H00010800-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cysteinyl Leukotriene R1/CysLTR1 Products

Bioinformatics Tool for Cysteinyl Leukotriene R1/CysLTR1 Partial Recombinant Protein (H00010800-Q01)

Discover related pathways, diseases and genes to Cysteinyl Leukotriene R1/CysLTR1 Partial Recombinant Protein (H00010800-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cysteinyl Leukotriene R1/CysLTR1 Partial Recombinant Protein (H00010800-Q01)

Discover more about diseases related to Cysteinyl Leukotriene R1/CysLTR1 Partial Recombinant Protein (H00010800-Q01).
 

Pathways for Cysteinyl Leukotriene R1/CysLTR1 Partial Recombinant Protein (H00010800-Q01)

View related products by pathway.

PTMs for Cysteinyl Leukotriene R1/CysLTR1 Partial Recombinant Protein (H00010800-Q01)

Learn more about PTMs related to Cysteinyl Leukotriene R1/CysLTR1 Partial Recombinant Protein (H00010800-Q01).
 

Research Areas for Cysteinyl Leukotriene R1/CysLTR1 Partial Recombinant Protein (H00010800-Q01)

Find related products by research area.

Blogs on Cysteinyl Leukotriene R1/CysLTR1

There are no specific blogs for Cysteinyl Leukotriene R1/CysLTR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cysteinyl Leukotriene R1/CysLTR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CYSLTR1
Entrez