Cystatin-9 Antibody

Images

 
Immunohistochemistry-Paraffin: Cystatin-9 Antibody [NBP1-85565] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cystatin-9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GGNNKIVQDPMFFATVEFALNTFNVQSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CST9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cystatin-9 Protein (NBP1-85565PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cystatin-9 Antibody

  • cystatin 9 (testatin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-09552
Species: Hu
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-46231
Species: Hu
Applications: WB, IHC
AF4478
Species: Hu
Applications: WB, IHC
H00005670-T01
Species: Hu
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
MAB27881
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-47219
Species: Hu
Applications: WB, PEP-ELISA
AF2009
Species: Hu
Applications: WB, IHC
NBP1-85565
Species: Hu
Applications: IHC, IHC-P

Publications for Cystatin-9 Antibody (NBP1-85565) (0)

There are no publications for Cystatin-9 Antibody (NBP1-85565).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cystatin-9 Antibody (NBP1-85565) (0)

There are no reviews for Cystatin-9 Antibody (NBP1-85565). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cystatin-9 Antibody (NBP1-85565) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cystatin-9 Products

Bioinformatics Tool for Cystatin-9 Antibody (NBP1-85565)

Discover related pathways, diseases and genes to Cystatin-9 Antibody (NBP1-85565). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cystatin-9 Antibody (NBP1-85565)

Discover more about diseases related to Cystatin-9 Antibody (NBP1-85565).
 

Pathways for Cystatin-9 Antibody (NBP1-85565)

View related products by pathway.

Blogs on Cystatin-9

There are no specific blogs for Cystatin-9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cystatin-9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CST9