CYP4A22 Antibody

Western Blot: CYP4A22 Antibody [NBP1-80495] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml

Immunohistochemistry-Paraffin: CYP4A22 Antibody [NBP1-80495] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CYP4A22 Antibody Summary

• Immunogen: Synthetic peptide directed towards the N terminal of human CYP4A22. Peptide sequence MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CYP4A22
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against CYP4A22 and was validated on Western Blot and immunohistochemistry.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CYP4A22 Antibody

• CYPIVA22
• cytochrome P450 4A22K
• cytochrome P450, family 4, subfamily A, polypeptide 22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CYP4A22
• Uniprot:
  • NP_001010969(Human)