We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

CYP3A43 Antibody - BSA Free

Images

 
Western Blot: CYP3A43 Antibody [NBP1-69413] - This Anti-CYP3A43 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: CYP3A43 Antibody [NBP1-69413] - Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody ...read more

Product Details

Summary
Product Discontinued
View other related CYP3A43 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69413
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

CYP3A43 Antibody - BSA Free Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to CYP3A43(cytochrome P450, family 3, subfamily A, polypeptide 43) The peptide sequence was selected from the C terminal of CYP3A43. Peptide sequence IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP3A43
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for CYP3A43 Antibody - BSA Free

  • cytochrome P450 3A43
  • cytochrome P450 polypeptide 43
  • cytochrome P450, family 3, subfamily A, polypeptide 43
  • cytochrome P450, subfamily IIIA, polypeptide 43
  • EC 1.14.14.1
  • MGC119315
  • MGC119316

Background

CYP3A43 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Alternate splicing of this gene results in three transcript variants encoding different isoforms.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Alternate splicing of this gene results in three transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-68885
Species: Hu
Applications: IHC, WB
NBP3-11914
Species: Hu
Applications: ELISA, IHC, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
H00113612-P01
Species: Hu
Applications: ELISA, AP, PA, WB
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
NBP3-16627
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-48063
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP2-01860
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-37003
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA
AF2654
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-46510
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-47935
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32883
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP2-48733
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: EM, IHC,  IHC-P, WB
NBP2-50215
Species: Hu
Applications: ELISA, IHC, WB

Publications for CYP3A43 Antibody (NBP1-69413) (0)

There are no publications for CYP3A43 Antibody (NBP1-69413).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP3A43 Antibody (NBP1-69413) (0)

There are no reviews for CYP3A43 Antibody (NBP1-69413). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP3A43 Antibody (NBP1-69413) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP3A43 Products

Research Areas for CYP3A43 Antibody (NBP1-69413)

Find related products by research area.

Blogs on CYP3A43

There are no specific blogs for CYP3A43, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP3A43 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP3A43
Uniprot