CYP27A1 Recombinant Protein Antigen

Images

 
There are currently no images for CYP27A1 Protein (NBP2-32433PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CYP27A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CYP27A1.

Source: E.coli

Amino Acid Sequence: RQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLD

Protein/Peptide Type
Recombinant Protein Antigen
Gene
CYP27A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-32433.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CYP27A1 Recombinant Protein Antigen

  • 12-alpha-triol 27-hydroxylase
  • 7-alpha
  • cholestanetriol 26-monooxygenase
  • CP27,5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 27-hydroxylase
  • CTX5-beta-cholestane-3-alpha
  • CYP275-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 26-hydroxylase
  • Cytochrome P450 27
  • cytochrome P450, family 27, subfamily A, polypeptide 1
  • cytochrome P450, subfamily XXVIIA (steroid 27-hydroxylase, cerebrotendinousxanthomatosis), polypeptide 1
  • Cytochrome P-450C27/25
  • EC 1.14.13.15
  • sterol 26-hydroxylase, mitochondrial
  • Sterol 27-hydroxylase
  • Vitamin D(3) 25-hydroxylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
MAB9120
Species: Hu
Applications: ICC
NBP2-35213
Species: Hu
NBP1-85495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-50204
Species: Hu, Mu
Applications: WB, ELISA, IHC
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
H00009420-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CYP27A1 Protein (NBP2-32433PEP) (0)

There are no publications for CYP27A1 Protein (NBP2-32433PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP27A1 Protein (NBP2-32433PEP) (0)

There are no reviews for CYP27A1 Protein (NBP2-32433PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for CYP27A1 Protein (NBP2-32433PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CYP27A1 Products

Bioinformatics Tool for CYP27A1 Protein (NBP2-32433PEP)

Discover related pathways, diseases and genes to CYP27A1 Protein (NBP2-32433PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP27A1 Protein (NBP2-32433PEP)

Discover more about diseases related to CYP27A1 Protein (NBP2-32433PEP).
 

Pathways for CYP27A1 Protein (NBP2-32433PEP)

View related products by pathway.

PTMs for CYP27A1 Protein (NBP2-32433PEP)

Learn more about PTMs related to CYP27A1 Protein (NBP2-32433PEP).
 

Research Areas for CYP27A1 Protein (NBP2-32433PEP)

Find related products by research area.

Blogs on CYP27A1

There are no specific blogs for CYP27A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CYP27A1 Antibody
NBP2-32433
CYP27A1 Antibody
NBP2-32433
CYP27A1 Antibody
NBP2-32433
IL-2 [Unconjugated]
202-IL-010/CF
IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CYP27A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP27A1