CYP1B1 Antibody (2F8)

Product Discontinued

CYP1B1 Antibody (2F8) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CYP1B1 (NP_000095 453 a.a. - 542 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NKDLTSRVMIFSVGKRRCIGEELSKMQLFLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKETC
• Specificity: cytochrome P450, family 1, subfamily B, polypeptide 1
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CYP1B1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
• Application Notes: Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CYP1B1 Antibody (2F8)

• aryl hydrocarbon hydroxylase
• CP1B
• CYP1B1
• CYPIB1
• cytochrome P450 1B1
• cytochrome P450, family 1, subfamily B, polypeptide 1
• cytochrome P450, subfamily I (dioxin-inducible), polypeptide 1 (glaucoma 3
• EC 1.14.14.1
• EC 4.2.1.152
• flavoprotein-linked monooxygenase
• GLC3A
• microsomal monooxygenase
• P4501B1
• primary infantile)
• xenobiotic monooxygenase

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CYP1B1
• Entrez:
  • 1545(Human)
• OMIM:
  • 137750(Human)
• Uniprot:
  • NP_000095(Human)