Recombinant Human Cyclin T1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cyclin T1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human CCNT1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SNLTSVEMLPGKRWLSSQPSFKLEPTQGHRTSENLALTGVDHSLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CCNT1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cyclin T1 Protein

  • CCNT
  • CCNT1
  • CCNTcyclin-T
  • CDK9-associated C-type protein
  • cyclin C-related protein
  • cyclin T1
  • cyclin T1b
  • Cyclin-T
  • cyclin-T1
  • CYCT1
  • HIVE1
  • human immunodeficiency virus type 1 (HIV-1) expression (elevated) 1
  • Human immunodeficiency virus-1 expression
  • subunit of positive elongation transcription factor b

Background

CCNT1 - cyclin T1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87592
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-71867
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-06519
Species: Hu
Applications: WB, IHC-P, IP
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
AF2420
Species: Hu
Applications: WB, IHC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-581
Species: Hu
Applications: WB, IHC, IP, PLA
NBP1-80963
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000904-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Cyclin T1 Partial Recombinant Protein (H00000904-Q01) (0)

There are no publications for Cyclin T1 Partial Recombinant Protein (H00000904-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cyclin T1 Partial Recombinant Protein (H00000904-Q01) (0)

There are no reviews for Cyclin T1 Partial Recombinant Protein (H00000904-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cyclin T1 Partial Recombinant Protein (H00000904-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cyclin T1 Products

Cyclin T1 H00000904-Q01

Bioinformatics Tool for Cyclin T1 Partial Recombinant Protein (H00000904-Q01)

Discover related pathways, diseases and genes to Cyclin T1 Partial Recombinant Protein (H00000904-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cyclin T1 Partial Recombinant Protein (H00000904-Q01)

Discover more about diseases related to Cyclin T1 Partial Recombinant Protein (H00000904-Q01).
 

Pathways for Cyclin T1 Partial Recombinant Protein (H00000904-Q01)

View related products by pathway.

PTMs for Cyclin T1 Partial Recombinant Protein (H00000904-Q01)

Learn more about PTMs related to Cyclin T1 Partial Recombinant Protein (H00000904-Q01).
 

Research Areas for Cyclin T1 Partial Recombinant Protein (H00000904-Q01)

Find related products by research area.

Blogs on Cyclin T1

There are no specific blogs for Cyclin T1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD4 Antibody
NBP1-19371

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cyclin T1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CCNT1