Recombinant Human Cyclin C Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Cyclin C Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-283 of Human CCNC full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CCNC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
56.76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cyclin C Protein

  • CycC
  • cyclin C
  • cyclin-C
  • hSRB11
  • SRB11 homolog

Background

CCNC( AAH56153, 1 a.a. - 284 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24695
Species: Hu
Applications: WB, IHC-P
NBP2-67719
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-66192
Species: Hu
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, IP
NB100-60642
Species: Hu
Applications: WB, IP
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
NBP1-85495
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-31806
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: WB, IHC, IHC-P
AF6000
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP2-33466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05767
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, IHC-P
H00000892-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Cyclin C Recombinant Protein (H00000892-P01) (0)

There are no publications for Cyclin C Recombinant Protein (H00000892-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cyclin C Recombinant Protein (H00000892-P01) (0)

There are no reviews for Cyclin C Recombinant Protein (H00000892-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cyclin C Recombinant Protein (H00000892-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Cyclin C Recombinant Protein (H00000892-P01)

Discover related pathways, diseases and genes to Cyclin C Recombinant Protein (H00000892-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cyclin C Recombinant Protein (H00000892-P01)

Discover more about diseases related to Cyclin C Recombinant Protein (H00000892-P01).
 

Pathways for Cyclin C Recombinant Protein (H00000892-P01)

View related products by pathway.

PTMs for Cyclin C Recombinant Protein (H00000892-P01)

Learn more about PTMs related to Cyclin C Recombinant Protein (H00000892-P01).
 

Research Areas for Cyclin C Recombinant Protein (H00000892-P01)

Find related products by research area.

Blogs on Cyclin C

There are no specific blogs for Cyclin C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cyclin C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CCNC