| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 1C8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | CCNB1 (NP_114172, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLV |
| Marker | Mitosis Marker |
| Specificity | CCNB1 - cyclin B1 |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CCNB1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00000891-M01 | Applications | Species |
|---|---|---|
| Zhou W, Fang H, Wu Q et al. Ilamycin E, a natural product of marine actinomycete, inhibits triple-negative breast cancer partially through ER stress-CHOP-Bcl-2. Int J Biol Sci. 2019-06-10 [PMID: 31360114] |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IHC-P | Human | 12/26/2021 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Cyclin B1 Antibody (H00000891-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.