Recombinant Human CYBB/NOX2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CYBB/NOX2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 120-171 of Human CYBB/NOX2

Source: Wheat Germ

Amino Acid Sequence: LFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CYBB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
31.46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CYBB/NOX2 Protein

  • CGD
  • CGD91-phox
  • Cytochrome b(558) subunit beta
  • cytochrome b-245 heavy chain
  • cytochrome b-245, beta polypeptide
  • Cytochrome b558 subunit beta
  • EC 1.6.3
  • GP91-1
  • GP91PHOX
  • GP91-PHOX
  • Heme-binding membrane glycoprotein gp91phox
  • NADPH oxidase 2
  • Neutrophil cytochrome b 91 kDa polypeptide
  • NOX2chronic granulomatous disease
  • p22 phagocyte B-cytochrome
  • p91-PHOX
  • Superoxide-generating NADPH oxidase heavy chain subunit

Background

CYBB - cytochrome b-245, beta polypeptide (chronic granulomatous disease)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-790
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
NBP1-40974
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IP
NBP1-31546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-58849
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb, Sh
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82542
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-13676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1904
Species: Hu
Applications: WB, IHC, ICC
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF5758
Species: Hu
Applications: WB, IHC, ICC
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
AF3795
Species: Hu
Applications: WB, IP
NBP1-83139
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CYBB/NOX2 Partial Recombinant Protein (H00001536-Q01) (0)

There are no publications for CYBB/NOX2 Partial Recombinant Protein (H00001536-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYBB/NOX2 Partial Recombinant Protein (H00001536-Q01) (0)

There are no reviews for CYBB/NOX2 Partial Recombinant Protein (H00001536-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYBB/NOX2 Partial Recombinant Protein (H00001536-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CYBB/NOX2 Products

Bioinformatics Tool for CYBB/NOX2 Partial Recombinant Protein (H00001536-Q01)

Discover related pathways, diseases and genes to CYBB/NOX2 Partial Recombinant Protein (H00001536-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYBB/NOX2 Partial Recombinant Protein (H00001536-Q01)

Discover more about diseases related to CYBB/NOX2 Partial Recombinant Protein (H00001536-Q01).
 

Pathways for CYBB/NOX2 Partial Recombinant Protein (H00001536-Q01)

View related products by pathway.

PTMs for CYBB/NOX2 Partial Recombinant Protein (H00001536-Q01)

Learn more about PTMs related to CYBB/NOX2 Partial Recombinant Protein (H00001536-Q01).

Blogs on CYBB/NOX2

There are no specific blogs for CYBB/NOX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Nox4 Antibody
NB110-58849

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CYBB/NOX2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CYBB