CYB561D2 Antibody

Images

 
Western Blot: CYB561D2 Antibody [NBP2-84743] - Host: Rabbit. Target Name: CYB561D2. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYB561D2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CYB561D2. Peptide sequence: ALSAETESHIYRALRTASGAAAHLVALGFTIFVAVLARPGSSLFSWHPVL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CYB561D2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CYB561D2 Antibody

  • cytochrome b-561 domain containing 2,101F6cytochrome b561 domain-containing protein 2
  • putative tumor suppressor 101F6
  • Putative tumor suppressor protein 101F6
  • TSP10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001534-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00051364-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-76593
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NB100-565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NBP3-04411
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00010641-B01P
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-81283
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81501
Species: Hu, Rt
Applications: IHC, IHC-P, KD, WB
NBP1-47977
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-80898
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-757
Species: Hu
Applications: ChIP, IHC, IHC-P, WB
NBP1-81637
Species: Hu
Applications: IHC, IHC-P, WB
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
NBP2-00688
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-00201
Species: Hu
Applications: Flow, IF, IHC, PEP-ELISA
NBP2-84743
Species: Hu
Applications: WB

Publications for CYB561D2 Antibody (NBP2-84743) (0)

There are no publications for CYB561D2 Antibody (NBP2-84743).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYB561D2 Antibody (NBP2-84743) (0)

There are no reviews for CYB561D2 Antibody (NBP2-84743). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYB561D2 Antibody (NBP2-84743) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYB561D2 Products

Bioinformatics Tool for CYB561D2 Antibody (NBP2-84743)

Discover related pathways, diseases and genes to CYB561D2 Antibody (NBP2-84743). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYB561D2 Antibody (NBP2-84743)

Discover more about diseases related to CYB561D2 Antibody (NBP2-84743).
 

Pathways for CYB561D2 Antibody (NBP2-84743)

View related products by pathway.

Research Areas for CYB561D2 Antibody (NBP2-84743)

Find related products by research area.

Blogs on CYB561D2

There are no specific blogs for CYB561D2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYB561D2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYB561D2