CXX1 Antibody

Images

 
Western Blot: CXX1 Antibody [H00008933-B01P] - Analysis of CXX1 expression in transfected 293T cell line by CXX1 polyclonal antibody. Lane 1: CXX1 transfected lysate(22.99 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CXX1 Antibody Summary

Immunogen
CXX1 (AAH02410, 1 a.a. - 209 a.a.) full-length human protein. MGGGRGLLGRETLGPGGGCSGEGPLCYWPPPGSPPAPSLRASLPLEPPRCPLRSCSLPRSACLCSRNSAPGSCCRPWASLWSEPPPSPSSQPAPPMYIWTLSCAPAASWAPVTHWTDHPLPPLPSPLLPTRLPDDYIILPTDLRCHSHRHPSHPTDRLLLLVIWTHLGGIWAGHSPWTVIQTAGRPPRDLSPSARPISSPPPETSCVLA
Specificity
CXX1 - CAAX box 1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FAM127A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CXX1 Antibody

  • CAAX box 1
  • Cerebral protein 5
  • CXX1MAR8
  • family with sequence similarity 127, member A
  • Mammalian retrotransposon derived protein 8C
  • Mar8
  • MAR8CMGC117411
  • MART8
  • MART8C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-29469
Species: Hu, Rt, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
AF1384
Species: Hu
Applications: WB, IHC, ICC
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49538
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56552
Species: Hu
Applications: WB
NBP2-48952
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CXX1 Antibody (H00008933-B01P) (0)

There are no publications for CXX1 Antibody (H00008933-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXX1 Antibody (H00008933-B01P) (0)

There are no reviews for CXX1 Antibody (H00008933-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CXX1 Antibody (H00008933-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXX1 Products

Bioinformatics Tool for CXX1 Antibody (H00008933-B01P)

Discover related pathways, diseases and genes to CXX1 Antibody (H00008933-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXX1 Antibody (H00008933-B01P)

Discover more about diseases related to CXX1 Antibody (H00008933-B01P).
 

Pathways for CXX1 Antibody (H00008933-B01P)

View related products by pathway.

PTMs for CXX1 Antibody (H00008933-B01P)

Learn more about PTMs related to CXX1 Antibody (H00008933-B01P).

Blogs on CXX1

There are no specific blogs for CXX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM127A
Entrez
Uniprot