CXCL6/GCP-2 Antibody (2G3)

Images

 
There are currently no images for CXCL6/GCP-2 Antibody (H00006372-M07).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CXCL6/GCP-2 Antibody (2G3) Summary

Immunogen
CXCL6 (AAH13744, 38 a.a. - 114 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CXCL6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CXCL6/GCP-2 Antibody (2G3)

  • chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2)
  • Chemokine alpha 3
  • CKA-3Granulocyte chemotactic protein 2
  • CXCL6
  • GCP-2
  • GCP2member 6 (granulocytechemotactic protein 2)
  • GCP-2Small-inducible cytokine B6
  • Small inducible cytokine subfamily B (Cys-X-Cys), member b

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
MAB393
Species: Hu
Applications: WB, Simple Western, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB331
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
MAB330
Species: Hu
Applications: Flow, IHC, CyTOF-reported, Neut
795-P4/CF
Species: Hu
NBP2-36543
Species: Hu
Applications: WB, IP

Publications for CXCL6/GCP-2 Antibody (H00006372-M07) (0)

There are no publications for CXCL6/GCP-2 Antibody (H00006372-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CXCL6/GCP-2 Antibody (H00006372-M07) (0)

There are no reviews for CXCL6/GCP-2 Antibody (H00006372-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CXCL6/GCP-2 Antibody (H00006372-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXCL6/GCP-2 Products

Bioinformatics Tool for CXCL6/GCP-2 Antibody (H00006372-M07)

Discover related pathways, diseases and genes to CXCL6/GCP-2 Antibody (H00006372-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXCL6/GCP-2 Antibody (H00006372-M07)

Discover more about diseases related to CXCL6/GCP-2 Antibody (H00006372-M07).
 

Pathways for CXCL6/GCP-2 Antibody (H00006372-M07)

View related products by pathway.

PTMs for CXCL6/GCP-2 Antibody (H00006372-M07)

Learn more about PTMs related to CXCL6/GCP-2 Antibody (H00006372-M07).
 

Research Areas for CXCL6/GCP-2 Antibody (H00006372-M07)

Find related products by research area.

Blogs on CXCL6/GCP-2

There are no specific blogs for CXCL6/GCP-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXCL6/GCP-2 Antibody (2G3) and receive a gift card or discount.

Bioinformatics

Gene Symbol CXCL6
Entrez
Uniprot