Cullin 4a Antibody [Janelia Fluor® 669] Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-300 of human Cullin 4a (NP_001008895.1).
Sequence: IERERSGEAVDRSLLRSLLGMLSDLQVYKDSFELKFLEETNCLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEHLT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CUL4A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunoprecipitation
- Western Blot
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Notes
Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.
Alternate Names for Cullin 4a Antibody [Janelia Fluor® 669]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Ch, ChHa, Eq, Fe, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt
Applications: Flow, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP
Publications for Cullin 4a Antibody (NBP3-38019JF669) (0)
There are no publications for Cullin 4a Antibody (NBP3-38019JF669).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cullin 4a Antibody (NBP3-38019JF669) (0)
There are no reviews for Cullin 4a Antibody (NBP3-38019JF669).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Cullin 4a Antibody (NBP3-38019JF669) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cullin 4a Products
Research Areas for Cullin 4a Antibody (NBP3-38019JF669)
Find related products by research area.
|
Blogs on Cullin 4a