Cullin 2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Cullin 2 Antibody [NBP1-87544] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm.
Immunohistochemistry: Cullin 2 Antibody [NBP1-87544] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cullin 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQAILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQEIFESPFLTETGEYYKQEASNLLQESNCSQYMEKVLG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CUL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cullin 2 Protein (NBP1-87544PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cullin 2 Antibody

  • CUL-2
  • cullin 2
  • cullin-2
  • MGC131970

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-485
Species: Hu
Applications: WB, IP
NBP1-88742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00143384-B01P
Species: Hu
Applications: WB, ELISA
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-22970
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-37523
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-87544
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Cullin 2 Antibody (NBP1-87544) (0)

There are no publications for Cullin 2 Antibody (NBP1-87544).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cullin 2 Antibody (NBP1-87544) (0)

There are no reviews for Cullin 2 Antibody (NBP1-87544). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cullin 2 Antibody (NBP1-87544) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cullin 2 Products

Bioinformatics Tool for Cullin 2 Antibody (NBP1-87544)

Discover related pathways, diseases and genes to Cullin 2 Antibody (NBP1-87544). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cullin 2 Antibody (NBP1-87544)

Discover more about diseases related to Cullin 2 Antibody (NBP1-87544).
 

Pathways for Cullin 2 Antibody (NBP1-87544)

View related products by pathway.

PTMs for Cullin 2 Antibody (NBP1-87544)

Learn more about PTMs related to Cullin 2 Antibody (NBP1-87544).
 

Research Areas for Cullin 2 Antibody (NBP1-87544)

Find related products by research area.

Blogs on Cullin 2

There are no specific blogs for Cullin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cullin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CUL2