CTU1 Antibody - BSA Free

Immunohistochemistry: CTU1 Antibody [NBP2-47500] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CTU1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CTU1 Antibody - BSA Free (NBP2-47500) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLR
• Predicted Species: Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CTU1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CTU1 Protein (NBP2-47500PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CTU1 Antibody - BSA Free

• ATP binding domain 3
• ATPBD3cancer-associated protein
• Cancer-associated gene protein
• cytoplasmic tRNA 2-thiolation protein 1
• Cytoplasmic tRNA adenylyltransferase 1
• cytosolic thiouridylase subunit 1 homolog (S. pombe)
• EC 2.7.7
• EC 2.7.7.-
• MGC17332
• NCS6ATP-binding domain-containing protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTU1