Frequenin Antibody

Images

 
Western Blot: Frequenin Antibody [NBP1-89820] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: Frequenin Antibody [NBP1-89820] - Staining of human cell line U-2 OS shows localization to plasma membrane and vesicles.
Immunohistochemistry-Paraffin: Frequenin Antibody [NBP1-89820] - Staining in human cerebral cortex and liver tissues using anti-NCS1 antibody. Corresponding NCS1 RNA-seq data are presented for the same tissues.
Western Blot: Frequenin Antibody [NBP1-89820] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Western Blot: Frequenin Antibody [NBP1-89820] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: Frequenin Antibody [NBP1-89820] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: Frequenin Antibody [NBP1-89820] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Frequenin Antibody [NBP1-89820] - Staining of human liver shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Frequenin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
Specificity
Specificity of human, mouse Frequenin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Frequenin Protein (NBP1-89820PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Frequenin Antibody

  • DKFZp761L1223
  • FREQFLUP
  • frequenin (Drosophila) homolog
  • frequenin homolog (Drosophila)
  • Frequenin homolog
  • Frequenin-like protein
  • Frequenin-like ubiquitous protein
  • NCS-1
  • neuronal calcium sensor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33838
Species: Hu
Applications: IHC, IHC-P
NBP1-87088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001813-M01A
Species: Hu
Applications: WB, ELISA
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-52493
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-37530
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
H00006334-Q01
Species: Hu
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NBP1-85161
Species: Hu
Applications: IHC, IHC-P
H00001297-P01
Species: Hu
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-88457
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC

Publications for Frequenin Antibody (NBP1-89820) (0)

There are no publications for Frequenin Antibody (NBP1-89820).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Frequenin Antibody (NBP1-89820) (0)

There are no reviews for Frequenin Antibody (NBP1-89820). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Frequenin Antibody (NBP1-89820) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Frequenin Products

Bioinformatics Tool for Frequenin Antibody (NBP1-89820)

Discover related pathways, diseases and genes to Frequenin Antibody (NBP1-89820). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Frequenin Antibody (NBP1-89820)

Discover more about diseases related to Frequenin Antibody (NBP1-89820).
 

Pathways for Frequenin Antibody (NBP1-89820)

View related products by pathway.

PTMs for Frequenin Antibody (NBP1-89820)

Learn more about PTMs related to Frequenin Antibody (NBP1-89820).

Blogs on Frequenin

There are no specific blogs for Frequenin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Frequenin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCS1