Frequenin Antibody

Western Blot: Frequenin Antibody [NBP1-89820] - Analysis in control (vector only transfected HEK293T lysate) and NCS1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: Frequenin Antibody [NBP1-89820] - Staining of human cell line U-2 OS shows localization to plasma membrane and vesicles.

Immunohistochemistry-Paraffin: Frequenin Antibody [NBP1-89820] - Staining in human cerebral cortex and liver tissues using anti-NCS1 antibody. Corresponding NCS1 RNA-seq data are presented for the same tissues.

Western Blot: Frequenin Antibody [NBP1-89820] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue

Western Blot: Frequenin Antibody [NBP1-89820] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue

Immunohistochemistry-Paraffin: Frequenin Antibody [NBP1-89820] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: Frequenin Antibody [NBP1-89820] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: Frequenin Antibody [NBP1-89820] - Staining of human liver shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Frequenin Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
• Predicted Species: Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NCS1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Frequenin Protein (NBP1-89820PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Frequenin Antibody

• DKFZp761L1223
• FREQFLUP
• frequenin (Drosophila) homolog
• frequenin homolog (Drosophila)
• Frequenin homolog
• Frequenin-like protein
• Frequenin-like ubiquitous protein
• NCS-1
• neuronal calcium sensor 1

Background

Frequenin is a Ca2+ binding protein implicated in the regulation of neurotransmitter release at the neuromuscular junction. Frequenin amino acid sequences from different species appear closely related. In mouse a single 4.2 kbp mRNA is produced yielding a protein of 22 kDa when assayed by SDS-PAGE under reducing conditions. Frequenin may colocalize with the dendritic marker MAP-2 and is widely distributed in the brain, spinal cord and dorsal root ganglia. In Drosophila frequenin is related to recoverin and visinin and functions like Ca2+-sensitive guanylyl cyclase activator.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NCS1