Frequenin Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: YITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV |
| Predicted Species |
Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NCS1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Frequenin Antibody - BSA Free
Background
Frequenin is a Ca2+ binding protein implicated in the regulation of neurotransmitter release at the neuromuscular junction. Frequenin amino acid sequences from different species appear closely related. In mouse a single 4.2 kbp mRNA is produced yielding a protein of 22 kDa when assayed by SDS-PAGE under reducing conditions. Frequenin may colocalize with the dendritic marker MAP-2 and is widely distributed in the brain, spinal cord and dorsal root ganglia. In Drosophila frequenin is related to recoverin and visinin and functions like Ca2+-sensitive guanylyl cyclase activator.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, Func, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, WB
Species: Hu
Applications: ICC, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Species: Rt
Applications: WB
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Publications for Frequenin Antibody (NBP1-89820) (0)
There are no publications for Frequenin Antibody (NBP1-89820).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Frequenin Antibody (NBP1-89820) (0)
There are no reviews for Frequenin Antibody (NBP1-89820).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Frequenin Antibody (NBP1-89820) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Frequenin Products
Research Areas for Frequenin Antibody (NBP1-89820)
Find related products by research area.
|
Blogs on Frequenin