ZNF364 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ZNF364 Antibody [NBP1-85586] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ZNF364 Antibody [NBP1-85586] - Staining of human stomach shows strong cytoplasmic positivity in chief cells.

Analysis in control (vector only transfected HEK293T lysate) and rNF115 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNF364 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZNF364 Antibody - BSA Free (NBP1-85586) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and IP. Anti-ZNF364 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTHFAELWGHLDHTMFFQDFRPFLSSSPLDQDNRAN
• Predicted Species: Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF115
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZNF364 Protein (NBP1-85586PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZNF364 Antibody - BSA Free

• E3 ubiquitin-protein ligase RNF115
• EC 6.3.2.-
• Rabring 7
• ring finger protein 115CL469780
• Zinc finger protein 364BCA2
• ZNF364

Background

The RING finger family of proteins possess ubiquitin ligase activity and play pivotal roles in protein degradation and receptor-mediated endocytosis. The autoubiquitination activity of ZNF364 indicates that it is a novel RING-type E3 ligase. Its effects on cell growth indicate that ZNF364 may be important for the ubiquitin modification of proteins crucial to breast carcinogenesis and growth.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF364 Antibody (NBP1-85586)(1)

Publication using NBP1-85586

• Min Z, Wenjing L, Rou Z et al. E3 ubiquitin ligase BCA2 promotes breast cancer stemness by up-regulation of SOX9 by LPS Int J Biol Sci. 2024-04-29 [PMID: 38725852] (Immunohistochemistry, Immunoprecipitation, Human)

Bioinformatics

• Gene Symbol: RNF115